KEGG   Neisseria gonorrhoeae FA 1090: NGO0019Help
Entry
NGO0019           CDS       T00237                                 

Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Brite
Enzymes [BR:ngo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NGO0019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD Methyltransf_31 Methyltransf_11 CMAS Methyltr_RsmB-F Methyltransf_18 Methyltransf_12 Ubie_methyltran Methyltransf_23 MTS Methyltransf_3 Aconitase_2_N Methyltransf_32 Methyltransf_9
Motif
Other DBs
NCBI-GeneID: 3283075
NCBI-ProteinID: YP_207200
UniProt: Q5FAJ5
Position
16000..16656
Genome map
AA seq 218 aa AA seqDB search
MDFEKARFNMVEQQIRPWDVLDFDVLDALEEIPRELFADESLQGLAYADMELPLANGHKM
LEPKVVARLAQGLKLTKNDTVLEIGTGSGYATALLAKLAGRVVSDDIDAERQKRAKAVLD
GLSLENIDYVQNNGLTELSAGAPFDAVYVGGAVTLVPEVLKEQLKDGGRMAVIVGRRPVQ
RALLITRRGDVFEEKVLFDTLVAHLDDKDAHPFDSFNF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaaaaagcgcggttcaatatggtcgaacagcagatccgtccttgggatgta
ttggattttgacgtgttggacgctttggaggagattccgcgcgagcttttcgcggatgag
tctttgcagggtttggcgtatgcggatatggagctgccgcttgccaacggtcataagatg
ctcgagccgaaagtcgtggcgcggctggcgcagggcttgaagctgacgaaaaacgatacg
gttttggaaatcggcacgggttcgggctatgcgacggctctgttggcaaaactggctggc
cgtgtggtttcggacgacatcgatgccgaacggcaaaagcgcgccaaagcggttttggac
ggcttgtctttggaaaacatcgattatgtgcaaaataacgggttgaccgaactttccgca
ggtgcgccgtttgatgcggtttacgtcggcggcgcggtaacccttgtgcctgaagtgtta
aaggaacagttgaaggacggcgggcgtatggcggttattgtgggacgcaggccggtgcag
cgcgcgcttttgattacgcgcaggggcgatgtgtttgaagagaaggtgctgttcgatact
ttggtggcgcatttggacgacaaggatgcccatcctttcgacagttttaatttttga

DBGET integrated database retrieval system