KEGG   Neisseria gonorrhoeae FA 1090: NGO0186Help
Entry
NGO0186           CDS       T00237                                 

Definition
(RefSeq) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ngo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NGO0186
Enzymes [BR:ngo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NGO0186
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NGO0186
    1.1.1.-  
     NGO0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 TrkA_N NAD_binding_2 2-Hacid_dh_C Semialdhyde_dh 3HCDH_N AdoHcyase_NAD DUF3335 HI0933_like
Motif
Other DBs
NCBI-GeneID: 3281536
NCBI-ProteinID: YP_207353
UniProt: Q5FA46
Position
complement(186327..187391)
Genome map
AA seq 354 aa AA seqDB search
MKAARFYNKGDIRIEDIPEPTVAPGTVGINVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPVTMGHEFSGVVYAVGEGVDDIKVGQHVVVEPYIIRDDVPTGEGSNYHLSKDMNF
IGLGGCGGGLSEKIAVKRRWVHPISDKIPLDQAALIEPLSVGHHAYVRSGAKAGDVALVG
GAGPIGLLLAAVLKAKGIKVIITELSKARKDKARESGVADYILDPSEVDVVEEVKKLTNG
EGVDVAFECTSVNKVLDTLVEACKPAANLVIVSIWSHPATVNVHSVVMKELDVRGTIAYC
NDHAETIKLVEEGKINLEPFITQRIKLDKLVSEGFERLIHNNESAVKIIVNPNL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgtttttacaacaaaggcgacatccgcatcgaagacatccccgaaccg
accgtcgcccccggcaccgtcggcatcaatgtcgcctggtgcggcatctgcggtaccgac
ctgcacgaatttatggaaggcccgattttcatcccgccctgcggtcatccgcatccgatt
tccggcgagtccgcgcccgtaacgatgggacacgagttctccggcgtggtttatgccgtc
ggcgaaggcgtggacgacattaaagtcggccaacacgtcgtggtcgaaccctacatcatc
cgcgacgacgtaccgaccggcgaaggcagcaactaccacctctccaaagacatgaacttt
atcggcttgggcggctgcggcggcggcctgtccgaaaaaatcgccgtcaaacgccgttgg
gtgcatccgatttccgacaaaatcccgttggatcaagctgctttgattgaacctctgtct
gtcggacaccacgcctatgtacgcagcggcgcgaaagcaggcgatgtcgcattggtcggc
ggcgcaggcccgatcggtttgctgttggccgccgtgttgaaagccaaaggcatcaaagtc
atcattaccgagttgagtaaagcacgcaaagacaaagcccgcgaatccggcgttgccgac
tacatcctcgacccgtccgaagtcgatgttgttgaagaagtgaaaaaactgaccaacggc
gaaggcgtggacgtggcgttcgaatgtaccagcgtgaacaaagtgttggatactttggtc
gaagcctgcaaacccgccgccaacttggttatcgtatccatctggagccaccccgccacc
gtcaacgtccacagcgtcgtgatgaaagaactggatgtgcgcggcacgattgcctactgc
aacgaccacgcggaaaccatcaaactggtcgaagaaggcaaaatcaacctcgaacccttc
atcacccagcgcatcaagctggacaaactggtttccgaaggcttcgagcgtctgatccac
aacaacgaatccgccgttaaaattattgtgaatccaaacctgtaa

DBGET integrated database retrieval system