KEGG   Neisseria gonorrhoeae FA 1090: NGO0248Help
Entry
NGO0248           CDS       T00237                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo00260  Glycine, serine and threonine metabolism
ngo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ngo01100  Metabolic pathways
ngo01110  Biosynthesis of secondary metabolites
ngo01130  Biosynthesis of antibiotics
ngo01230  Biosynthesis of amino acids
Module
ngo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NGO0248 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NGO0248 (trpA)
Enzymes [BR:ngo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NGO0248 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth ZnuA ALF
Motif
Other DBs
NCBI-GeneID: 3281525
NCBI-ProteinID: YP_207413
UniProt: Q5F9Y6
Position
248915..249700
Genome map
AA seq 261 aa AA seqDB search
MSRIRQAFAALDGGKALIPYIAVGDPDIRTTLALMHGMVASGADILELGVPFSDPMADGP
VIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPIHKMGYREFAQEAAKAG
VDGVLTVDSPIETIDSLYRELKDNEVDCIFLIAPTTTEDRIKTIAELAGGFVYYVSLKGV
TGAASLDTDEVSRKIEYLRQYIDIPIGVGFGISNAESARKIGRVAAAIIVGSRIVKEIEN
NAGNEAAAVGALVKELKDAVR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaatccggcaggcttttgccgctttggatggcggaaaggcattgattccctat
attgcggtgggcgaccccgatattcggacaactttggcattgatgcacggcatggttgca
agcggtgcggatattttggagttgggcgtgccgttttccgatccgatggcggacgggccg
gttattcagcgtgcggcggagcgggcgttggcaaacgggatttcgctgcgcgatgtcttg
gatgtcgtcagaaaattccgtgaaaccgacacgcaaacgccggttgttttgatgggatat
ttgaatcccatacataagatgggttatcgggagtttgctcaggaagccgcaaaggcgggg
gtggacggcgtgttgacggtggattcccccatcgaaaccatcgattctttatatcgcgag
ctgaaggataacgaggtcgactgtattttcctgattgcgccgacgacgacggaagaccgt
attaaaaccattgccgagctggcaggcggatttgtctattatgtttcgctcaagggcgta
acgggcgcggcaagtttggatacggatgaggtttcgcgtaaaatagagtatttgcgtcag
tatatcgatattcccatcggtgtcggtttcggcatcagcaatgcggaaagcgcgcgcaaa
atcggccgggttgccgccgcgatcattgtcggcagccggattgtgaaagagattgaaaac
aatgcgggcaacgaggctgccgccgtcggtgctttggtcaaagagttaaaggatgccgtg
cgctga

DBGET integrated database retrieval system