KEGG   Neisseria gonorrhoeae FA 1090: NGO0665Help
Entry
NGO0665           CDS       T00237                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo00250  Alanine, aspartate and glutamate metabolism
ngo00650  Butanoate metabolism
ngo00760  Nicotinate and nicotinamide metabolism
ngo01100  Metabolic pathways
ngo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ngo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NGO0665
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NGO0665
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NGO0665
Enzymes [BR:ngo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     NGO0665
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     NGO0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh PSD4
Motif
Other DBs
NCBI-GeneID: 3282053
NCBI-ProteinID: YP_207804
UniProt: Q5F8U5
Position
655788..657131
Genome map
AA seq 447 aa AA seqDB search
MFHSVNVFTGETLYRRPDQDYAEFERRLADLKMHGRAFAQLGVTERAARLQKFAGRLEAE
KERFAEMVCEEVGRCLHECRAEIVKSIELIRYYARLAPELLAHKTIATQASLSQVRFEPL
GVVFAVMPWNYPVWQVLRFAVPAMCAGNACAVKPAPSVARVSRALFDLASDGIPLAGAWL
DEADTLKAVEDTDAMAFTGSTHTGRILAAHAGANLKKTVLELGGSNAFIVMPDADLERAA
AEACYSRFRDAGQSCNAAKRIIVTEAAADRFIQLFLAECAKLKMGDPKHPDTTLAPLHRE
DLRDRVHGQVEDAVSNGAVCLTGGKVPQGSGWFYPATVLDRVNPACRVWREEVFGPVALI
LRAENEEHAICLANDSPFGLGACIYTADTERAWRFAEKIQAGSVFINRHTSSDLRLPFGG
VKDSGYGRELSEFGLYEFVNVKTYWQK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtttcacagtgtcaatgtatttacgggcgaaacgctttaccgccgccccgatcaagat
tatgcggagtttgaacggcggctggcggatttgaaaatgcacggcagggcgttcgcgcaa
ttgggcgtaaccgaacgtgccgcgcgtctgcaaaaatttgccggccgtttggaggcggaa
aaagagcgttttgcggaaatggtgtgcgaagaagtcggacgctgcctgcacgaatgccgt
gccgaaatcgtcaagtctatcgaactgatacgctattacgcccgccttgcccccgaactg
cttgcccacaaaaccattgcgacgcaggcgagtttgagtcaggtgcgcttcgagcctttg
ggcgtggtgtttgccgtcatgccttggaactatcccgtctggcaggtattgcgtttcgcc
gttcccgctatgtgcgcgggcaacgcgtgcgccgtcaaacccgcgcccagcgtggcacgc
gtcagtcgggcgttgttcgatttggcttcagacggtattcctctggcaggcgcgtggctg
gatgaggcggacacgctcaaggcagtcgaagataccgatgcgatggcgtttaccggttcg
acgcatacggggcgcattcttgcggcacatgcgggcgcaaacctcaagaaaaccgtgttg
gagctcggcggcagcaacgcctttatcgtgatgcccgatgccgatttggaacgcgccgcc
gcagaagcctgttattcccgtttccgcgatgcggggcaatcgtgtaacgccgccaagcgc
atcatcgtaaccgaagccgcagccgaccgctttattcagctgtttctcgccgaatgcgcc
aaattgaaaatgggagacccgaaacatcccgataccacgcttgcaccgctgcaccgcgaa
gatttgcgggaccgggttcacgggcaggttgaagatgccgtttcaaacggcgcggtgtgc
ctgaccggaggcaaagttccacaggggtcggggtggttttaccctgcgacggttttagac
agggtaaatcctgcctgccgcgtctggagagaagaagtattcggccccgtcgccctgatt
ttgcgcgccgaaaacgaagaacacgccatctgccttgccaatgattccccgttcgggctc
ggtgcctgcatttataccgccgatactgaacgcgcctggcggtttgccgaaaaaatacag
gccggatcggtgtttatcaaccgccataccagcagcgatttgcgcctgcctttcggcgga
gtcaaagattccggttacgggcgcgaactgtccgaattcgggttgtacgagttcgtcaac
gtcaaaacctactggcagaaataa

DBGET integrated database retrieval system