KEGG   Neisseria gonorrhoeae FA 1090: NGO0862Help
Entry
NGO0862           CDS       T00237                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo00010  Glycolysis / Gluconeogenesis
ngo00030  Pentose phosphate pathway
ngo00051  Fructose and mannose metabolism
ngo00680  Methane metabolism
ngo01100  Metabolic pathways
ngo01110  Biosynthesis of secondary metabolites
ngo01120  Microbial metabolism in diverse environments
ngo01130  Biosynthesis of antibiotics
ngo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ngo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGO0862
   00030 Pentose phosphate pathway
    NGO0862
   00051 Fructose and mannose metabolism
    NGO0862
  09102 Energy metabolism
   00680 Methane metabolism
    NGO0862
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngo04147]
    NGO0862
Enzymes [BR:ngo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     NGO0862
Exosome [BR:ngo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NGO0862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase NdhM Flg_bb_rod
Motif
Other DBs
NCBI-GeneID: 3282373
NCBI-ProteinID: YP_207976
UniProt: Q5F8C3
Position
844641..845615
Genome map
AA seq 324 aa AA seqDB search
MDTLTRFLPEHLQQNQLPEALGGVLLSVVSACTEINAKVRLGALAGVLGMAGTGNIQGED
QKKLDVIANNIMIDTLKANPAVAGLASEEEDTFVSAGENGRYLVLFDPLDGSSNIDVNIS
VGTIFSILAKPEGALATESFLQTGRQQLAAGYVLYGPQTQLVFTFGHGVYVFTLNAENEF
VLTKENPKVPESTKEFAINMSNRRHWLPPVQQYVDELLAGETGTRGKNYNMRWVASMVAE
IHRILMRGGVFMYLQDKRDPSKPGKLRLMYEANPMALILEQAGASASNAYQAMLDIQPES
LHQRVAVIMGSSEEVDYLNRLHSK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggacacactgacccgattcctccccgaacacctgcaacaaaaccaactgcccgaagca
ctcggcggcgttttgctgtccgtcgtttccgcctgtaccgaaatcaacgccaaagtccgc
ctcggcgcacttgccggcgtattgggtatggcgggcacgggcaatattcagggtgaagac
cagaaaaaactggatgttatcgccaacaacattatgattgacacactcaaagccaaccct
gccgttgccggtttggcaagcgaggaagaagacactttcgtaagtgccggtgaaaacgga
cgctatctcgtcctattcgaccctttagacggatcgtccaatattgatgtcaacatttcc
gtcggtacgattttctccattctcgccaaacccgaaggcgcattggcaaccgaatcattc
cttcaaacgggcagacagcagcttgccgcaggctatgtcctctacgggcctcaaacccag
ctcgtattcacattcggacacggcgtgtacgtatttacactcaatgccgaaaacgaattt
gtgctgaccaaagaaaacccgaaagtacccgaaagtaccaaagaattcgccatcaatatg
tctaaccgccgccactggctaccccccgttcaacaatacgtcgacgagctcttggcgggc
gaaaccggtacgcgcggcaaaaactacaatatgcgctgggtagccagtatggttgccgaa
atccaccgcatcctgatgcgcggcggcgtgttcatgtatctgcaagacaaacgcgacccg
tccaaacccggcaaactgcgcctgatgtacgaagccaaccctatggccctgatactcgaa
caggcgggcgcatcggcaagcaacgcatatcaagccatgctcgatatacagcccgaaagc
ctgcaccaacgcgtcgccgtcattatgggcagcagcgaagaagtggattacctcaaccgt
ctgcattcaaaatag

DBGET integrated database retrieval system