KEGG   Neisseria gonorrhoeae FA 1090: NGO0922Help
Entry
NGO0922           CDS       T00237                                 

Definition
(RefSeq) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo00020  Citrate cycle (TCA cycle)
ngo00190  Oxidative phosphorylation
ngo00650  Butanoate metabolism
ngo01100  Metabolic pathways
ngo01110  Biosynthesis of secondary metabolites
ngo01120  Microbial metabolism in diverse environments
ngo01130  Biosynthesis of antibiotics
ngo01200  Carbon metabolism
Module
ngo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ngo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ngo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NGO0922
   00650 Butanoate metabolism
    NGO0922
  Energy metabolism
   00190 Oxidative phosphorylation
    NGO0922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-GeneID: 3281726
NCBI-ProteinID: YP_208030
UniProt: Q5F869
Position
complement(903426..903767)
Genome map
AA seq 113 aa AA seqDB search
MVERKLTGAHYGLRDWVMQRATAVIMLIYTVALLVVLFALPKEYPAWQAFFSQAWVKVFT
QVSFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSVKVIWG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacgtaaattgaccggtgcccattacggtttgcgcgattgggtaatgcagcgt
gcgactgcggttattatgttgatttataccgttgcacttttagtggttctatttgccctg
cctaaagaatatccggcatggcaggcattttttagtcaagcttgggtaaaagtatttacc
caagtgagctttatcgccgtattcttgcacgcttgggtgggtatccgcgatttgtggatg
gactatatcaaacccttcggcgtgcgtttgtttttgcaggttgccaccattgtctggctg
gtcggctgcctcgtgtattcagttaaagtgatttgggggtaa

DBGET integrated database retrieval system