KEGG   Neisseria gonorrhoeae FA 1090: NGO0933Help
Entry
NGO0933           CDS       T00237                                 

Gene name
metX
Definition
(RefSeq) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo00270  Cysteine and methionine metabolism
ngo00920  Sulfur metabolism
ngo01100  Metabolic pathways
ngo01110  Biosynthesis of secondary metabolites
ngo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ngo00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    NGO0933 (metX)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NGO0933 (metX)
Enzymes [BR:ngo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     NGO0933 (metX)
    2.3.1.46  homoserine O-succinyltransferase
     NGO0933 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Esterase Abhydrolase_6 Ser_hydrolase
Motif
Other DBs
NCBI-GeneID: 3282566
NCBI-ProteinID: YP_208041
UniProt: Q5F858
Position
911429..912568
Genome map
AA seq 379 aa AA seqDB search
MSQNTSVGIVTPQKIPFEMPLVLENGKTLPRFDLMIETYGELNAEKNNAVLICHALSGNH
HVAGRHSAEDKYTGWWDNMVGPGKPIDTERFFVVGLNNLGGCDGSSGPLSINPETGREYG
ADFPMVTVKDWVKSQAALADYLGIEQWAAVVGGSLGGMQALQWAISYPERVRHALVIASA
PKLSAQNIAFNDVARQAILTDPDFNEGHYRSHNTVPARGLRIARMMGHITYLAEDGLGKK
FGRDLRSNGYQYGYSVEFEVESYLRYQGDKFVGRFDANTYLLMTKALDYFDPAADFGNSL
TRAVQDVQAKFFVASFSTDWRFAPERSHELVKALIAAQKSVQYIEVKSAHGHDAFLMEDE
AYMRAVTAYMNNVDKDCRL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaatacctcggtgggcattgtaacgccccaaaaaattccgtttgaaatgccg
ctggttttggaaaacggtaaaactttgccgcgtttcgatctgatgattgaaacctacggc
gagctgaatgctgaaaaaaacaatgcggttttaatctgccacgcgctgtcgggcaaccat
cacgttgcgggcaggcattcggcggaggataaatatacgggctggtgggacaatatggtc
ggtcccggaaaaccgattgatacggaacgttttttcgtggtcgggttgaacaatctgggc
ggctgcgacggcagcagcgggcctttgtcgatcaatcctgaaacgggcagggaatacggc
gcggattttccgatggttacggtgaaggactgggtaaaatcacaagccgcgcttgccgat
tatctcggcatcgaacaatgggcggcggttgtcggcggcagcttgggcggcatgcaggct
ttgcagtgggcgatttcctatcccgaacgtgtgcgccacgccttggtgattgcgtctgcg
ccgaaactgtccgcgcaaaatatcgcgtttaatgatgtagcacgtcaggcgattttgacc
gaccccgatttcaatgaaggacattaccgcagccacaacaccgttcccgcgcgcggtttg
cggattgcccgtatgatgggacacattacgtatcttgccgaagacggtttgggcaaaaaa
ttcggacgcgatttgcgttccaacggctatcaatacggctatagcgttgaatttgaagta
gaatcctatctccgctatcaaggcgacaaattcgtcgggcggtttgatgctaatacatat
ttgctgatgaccaaagctttggactatttcgatccggcggcggatttcggcaacagcctg
acccgcgccgtgcaggatgtgcaggcaaaattctttgtcgccagcttcagcaccgactgg
cgtttcgcgcccgaacgttcgcacgaactggtcaaggcactgattgccgcccaaaaatcc
gtgcagtatatcgaagtcaagtccgcacacgggcacgatgcctttttaatggaagacgaa
gcctatatgcgcgccgtaacggcttatatgaacaatgttgacaaggattgccgattatga

DBGET integrated database retrieval system