KEGG   Neisseria gonorrhoeae FA 1090: NGO1486Help
Entry
NGO1486           CDS       T00237                                 

Definition
(RefSeq) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo00330  Arginine and proline metabolism
ngo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NGO1486
Enzymes [BR:ngo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     NGO1486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 3281617
NCBI-ProteinID: YP_208536
UniProt: Q5F6R3
Position
complement(1449376..1450299)
Genome map
AA seq 307 aa AA seqDB search
MQYSTLAGQTDNSLVSNNFGFLRLPLNFMPYESHADWVITGVPYDMAVSGRSGARFGPEA
IRRASVNLAWEHRRFPWTFDVRERLNIIDCGDLVFSFGDSRDFVEKMEAHAGKLLSFGKR
CLSLGGDHFITLPLLRAHARYFGKLALIHFDAHTDTYDNGSEYDHGTMFYTAPKEGLIDP
SRSVQIGIRTEHSKKLPFTVLSAPKVNEDSVEETVRKIKETVGNMPVYLTFDIDCLDPSF
APGTGTPVCGGLSSDRALKILRGLTDLDIVGMDVVEVAPSYDQSDITALAGATIALEMLY
LQGAKKD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacagcacactggcaggacaaaccgacaactccctcgtttccaataatttcggg
tttttgcgcctgccgcttaattttatgccgtatgaaagccatgccgattgggttattacc
ggcgtgccttatgatatggcggtttcagggcgttccggcgcgcgtttcggtcctgaagcc
atccggcgcgcctccgtcaacctcgcttgggagcaccgcaggtttccgtggacatttgat
gtgcgcgaacgcctgaacattattgattgcggcgacttggttttttcttttggcgacagc
agggattttgtcgaaaaaatggaagcgcacgccggcaaattactttctttcggcaaacgc
tgtttgagtttgggcggcgaccatttcattaccctcccgttgttgcgcgcccacgcccgc
tatttcggcaaactcgcactgattcattttgacgcgcacaccgacacctacgacaacggc
agcgaatacgaccacggcacgatgttttataccgcccccaaggaaggcctcatcgacccg
tcccgttccgtacaaatcggcatacgcaccgaacacagtaaaaaattgccttttactgtg
ttgtccgcccccaaagtcaatgaagacagtgttgaagagaccgtccgtaaaatcaaagaa
accgtcggcaatatgcccgtttacctgactttcgacatagactgtctcgacccgtcgttc
gcccccgggaccggtacgcccgtatgcggcggcttgagcagcgacagggcattaaaaatc
ctacgtgggctgacggatctcgacatcgtcggtatggatgttgtagaagttgccccctct
tacgaccaatccgacattaccgctttggccggcgccacaattgccttggaaatgctttac
cttcaaggtgcgaaaaaggactga

DBGET integrated database retrieval system