KEGG   Neisseria gonorrhoeae FA 1090: NGO1779Help
Entry
NGO1779           CDS       T00237                                 

Definition
(RefSeq) Ferric uptake regulation protein
  KO
K03711  Fur family transcriptional regulator, ferric uptake regulator
Organism
ngo  Neisseria gonorrhoeae FA 1090
Brite
KEGG Orthology (KO) [BR:ngo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngo03000]
    NGO1779
Transcription factors [BR:ngo03000]
 Prokaryotic Type
  Helix-turn-helix
   Fur family
    NGO1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FUR TF_Zn_Ribbon PadR HTH_Crp_2 Arg_repressor HTH_32
Motif
Other DBs
NCBI-GeneID: 3282476
NCBI-ProteinID: YP_208810
UniProt: Q5F5Y9
Position
complement(1748916..1749350)
Genome map
AA seq 144 aa AA seqDB search
MEKFSNIAQLKDSGLKVTGPRLKILDLFEKHAEEHLSAEDVYRILLEEGVEIGVATIYRV
LTQFEQAGILQRHHFETGKAVYELDKGDHHDHIVCVKCGEVTEFHNPEIEALQDKIAEEN
GYRIVDHALYMYGVCSDCQAKGKR
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattcagcaacattgcgcaactgaaagacagcggtctgaaggttaccggcccg
cgtttgaagattttggatttgttcgagaagcacgcggaagagcatttgagtgcggaagat
gtgtaccgcattctgctggaagagggcgtggaaatcggtgtggcgacgatttaccgcgtg
ctgacgcagttcgagcaggcgggcattctgcaacgccaccattttgaaacgggcaaggcg
gtttatgagttggacaagggcgaccaccacgaccatatcgtctgcgtgaagtgcggcgag
gtaacggaattccacaatcccgaaatcgaagccctgcaagacaaaatcgccgaggaaaac
ggctaccgcatcgtcgatcacgcgctttatatgtacggcgtgtgcagcgactgtcaggcc
aagggcaaacgttaa

DBGET integrated database retrieval system