KEGG   Naegleria gruberi: NAEGRDRAFT_29572Help
Entry
NAEGRDRAFT_29572  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ngr  Naegleria gruberi
Pathway
ngr04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NAEGRDRAFT_29572
Enzymes [BR:ngr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NAEGRDRAFT_29572
Chaperones and folding catalysts [BR:ngr03110]
 Protein folding catalysts
  Protein disulfide isomerase
   NAEGRDRAFT_29572
Membrane trafficking [BR:ngr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    NAEGRDRAFT_29572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin ERp29 OST3_OST6 Thioredoxin_2 Thioredoxin_8 AhpC-TSA Thioredoxin_7 Thioredoxin_6 Redoxin
Motif
Other DBs
NCBI-GeneID: 8863463
NCBI-ProteinID: XP_002682926
JGI: Naegr1_29572
AA seq 343 aa AA seqDB search
MEGIIDLTNANAASVLDGSKGVLVEFYAPWCGHCKNLAPEMVKLGQALIKAKPTIVAVAK
INCDNERDVCSKYGVQGYPTLKYFPRGSSEPIEYNSGRTVEAMVDFINQKEPSSRLRIAK
EPTFVEDLSPQTFDKIVLDSEKNVLVKFYAPWCGHCKKMAPDYEKVAKAFLNEKSVVVAH
VDCDKYRDLCSKYGVQGYPTLKFFPAKENKEAEEYNSGREAPAFLEFLNNKAGTSRNIEG
ALSEKAGVLASMVGPVKKFLAASTVEDKKKVIAEVEATVSSLVGAAKANADVYAKAMARI
VEKGAEYVATEVARLEKILAGGSVSGDRADAMKIRMNVLKTFN
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtatcattgatcttactaatgccaatgctgcttctgttcttgatggatccaag
ggtgtccttgttgaattctatgctccatggtgtggacattgtaagaatcttgccccagaa
atggtcaaactcggtcaagctttgatcaaagccaagccaaccattgttgctgttgctaaa
attaactgtgataacgaaagagatgtttgttccaagtatggtgttcaaggttatccaact
ttgaagtacttcccacgtggatcatccgaaccaattgaatacaatagcggaagaactgtt
gaagctatggttgatttcattaatcaaaaggaaccaagctccagattgagaattgccaag
gaaccaacctttgttgaagatcttagcccacaaacctttgacaagattgtcttggatagt
gaaaagaatgttttggttaaattctatgctccatggtgtggacattgtaagaagatggct
ccagactatgaaaaggttgccaaggctttcctcaatgaaaagagtgttgttgttgctcat
gttgattgcgacaagtatagagatctctgttccaagtatggcgttcaaggttatccaact
ttgaagttcttcccagctaaggaaaataaggaagctgaagaatataactctggtagagaa
gctccagctttcctcgaatttttgaacaataaggctggtacttcacgtaatattgaagga
gccttgtctgaaaaggctggtgttctcgccagtatggttggtccagtcaagaagttcctt
gccgcttctactgttgaagataagaagaaggttattgctgaagttgaagctacagtcagt
tccttggttggtgctgctaaggctaatgctgatgtctatgctaaggctatggctcgtatt
gttgaaaagggtgctgaatacgttgctactgaagttgccagattggaaaagattttggct
ggtggttcagtttctggtgatagagctgatgccatgaagattagaatgaacgttttgaag
accttcaattaa

DBGET integrated database retrieval system