KEGG   Naegleria gruberi: NAEGRDRAFT_30263Help
Entry
NAEGRDRAFT_30263  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
ngr  Naegleria gruberi
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NAEGRDRAFT_30263
Enzymes [BR:ngr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     NAEGRDRAFT_30263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP Exotox-A_cataly
Motif
Other DBs
NCBI-GeneID: 8852638
NCBI-ProteinID: XP_002682002
JGI: Naegr1_30263
AA seq 215 aa AA seqDB search
MHRIFFTHPTIADNGLYPRSWGKVLDDHCKCVKLSHSSSEFKEVEKTFIQRINHSHPTAQ
VIDIERVENAKLWRAFSIKKSETIHKNQNIKAENQVKTLYHGAEETAVDAITKTGFDYRR
CQVGHYGHGNYFAVNASYSHGYAKPSTSDGSRRIIVCKVVVGESLRVAQKDNTLRRPQDK
TTGKMYDSVQGGPTGTEYVVFDNESPYPGYIVIYK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcacagaattttctttacccatccaacaatagctgacaatggcttgtatccaagatct
tggggaaaggtgttggacgatcattgtaaatgtgttaagctttcacatagctcttcagaa
ttcaaagaggtagagaaaacatttattcaaagaattaatcacagccatccaactgctcaa
gtaatcgacattgaaagagtggaaaatgccaagttatggagagctttctcaattaagaaa
tcagaaaccattcacaagaatcaaaatatcaaagctgaaaatcaagtgaaaacactctac
catggagctgaagaaacagcagtcgatgccatcaccaaaacaggatttgattatagacga
tgccaagttggacattatggacatggaaattattttgcagtcaatgctagttatagtcat
ggttatgccaagccatcaacttctgatggtagtagaaggataattgtttgtaaggtagtt
gttggagaatctctcagagtagcacagaaggataatactctgagaagacctcaggataag
acaacaggtaaaatgtatgattcagtacagggaggaccaacaggaactgaatatgtagta
ttcgataacgaatctccatatcctggatatattgtaatttacaaataa

DBGET integrated database retrieval system