KEGG   Naegleria gruberi: NAEGRDRAFT_34997Help
Entry
NAEGRDRAFT_34997  CDS       T01241                                 

Definition
(RefSeq) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ngr  Naegleria gruberi
Pathway
ngr00970  Aminoacyl-tRNA biosynthesis
ngr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NAEGRDRAFT_34997
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ngr03029]
    NAEGRDRAFT_34997
Enzymes [BR:ngr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     NAEGRDRAFT_34997
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     NAEGRDRAFT_34997
Mitochondrial biogenesis [BR:ngr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NAEGRDRAFT_34997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 8860128
NCBI-ProteinID: XP_002682443
JGI: Naegr1_34997
AA seq 492 aa AA seqDB search
MPSPQEASKLLSLCFSKAKASSSFKNGEGVLNYCLNKASENKFNAYIRTCPEYAKKKLDE
SHEKPEHPLKGVPFAVKDAFCTQGIQTTMASNILKDYIPPYTATVVKRLEDVGAVMIGKT
NMDEFAMGSGTIFGAFGETRNPLDEKKIAGGSSGGSAACVAEESCFFSLGTDTGGSVRLP
ASYCGVVGFKPSYGSCSRYGMISYGSSLDTCGIFSKTVRESAIVFNTLSGNDQNDPTTKL
NVSPVDLSKLDSIDNEYNKGILKNVKIGIPVEYFVDELNDNIVKVWEETIKWIQDQTGAQ
VEYVSLPHSKEALSTYYVIATAEASSNLSRYDGLRYGNKVSKNQDLLAYYLQNRSEGFGN
EVLRRIVSGNFALSVDKYDTFFKKAQQTRRLIANDFYQVLQDQGIDYLLTPCTPTPAIDR
DLFTKMSPVEMFVNDIFTVPSSLAGVPAISVPIEINDPNKEGSKSKIGLQLIALSEQSCL
EGATVLEKVKLA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaccacaagaagcatccaaattgctttccctctgtttttctaaagcaaaggct
tcatcatcttttaaaaacggagaaggagttttgaattattgtttgaacaaggcttcggaa
aataaatttaatgcctacattagaacatgtccagagtatgccaagaaaaagttggatgaa
tcacatgaaaaaccagaacatccacttaaaggtgttccttttgctgtgaaggatgctttc
tgtacgcaaggaattcaaacaacaatggctagtaatattcttaaggattacattccacca
tacacagctactgtagtaaaacgattggaagatgtaggtgctgtcatgattggaaaaaca
aatatggatgagtttgctatgggaagtggtacaatttttggagcttttggagaaactaga
aatccactcgatgaaaagaaaattgctggaggaagttcaggaggtagtgctgcttgtgtt
gctgaggaaagttgtttcttctctttaggtactgatacaggtggtagtgttcgtttacct
gcatcatattgtggagttgttgggtttaaaccatcctatggttcatgcagtagatatggt
atgatttcttatggatcttctcttgatacttgtggaattttctcaaagactgtcagggaa
agtgcaattgtttttaatactcttagtggaaatgatcaaaatgatccaactacaaaactc
aatgtttcacctgtggatttatctaaattggattcaattgataatgaatataataaggga
atactcaagaatgtcaagattggtattcctgttgaatatttcgttgatgaattgaatgat
aatattgttaaagtttgggaagaaactattaaatggatacaagatcaaactggagctcaa
gttgaatatgtttccttaccacactcaaaagaagctctctctacttattatgttattgca
acagctgaggcttcttccaatttatctagatatgatggtttgagatatggtaataaggtc
tcaaagaatcaagatttacttgcatattatttacaaaatagaagcgaaggttttggaaat
gaagttttgagaagaattgtttctggtaattttgccctttcagtagataagtatgatacc
ttcttcaagaaggcccaacaaaccagaagattaattgctaacgatttttatcaagtttta
caagatcaaggaattgattatttattaacgccttgcacacctaccccagctattgataga
gatttatttacaaagatgtcacctgtggaaatgtttgttaatgatatctttaccgttcca
agcagtttagcaggtgtgccagcaatatctgtgcctattgaaattaatgatccaaataag
gagggttccaaatcaaagattggtttacaattaattgctttgagtgaacaatcatgtctc
gaaggtgccactgttttagagaaagttaaacttgcttaa

DBGET integrated database retrieval system