KEGG   Naegleria gruberi: NAEGRDRAFT_38279Help
Entry
NAEGRDRAFT_38279  CDS       T01241                                 

Definition
(RefSeq) dipeptidylpeptidase
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
ngr  Naegleria gruberi
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ngr01002]
    NAEGRDRAFT_38279
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     NAEGRDRAFT_38279
Peptidases [BR:ngr01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   NAEGRDRAFT_38279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49 Mucin15 MSA-2c
Motif
Other DBs
NCBI-GeneID: 8861768
NCBI-ProteinID: XP_002680194
JGI: Naegr1_38279
AA seq 683 aa AA seqDB search
MTIAQVLQDEKLKHFVCPEKVPVTRLELDEAWNALDEQQKLYAHYFSRAAISGTGIVLGQ
CSEESPLIYKLLVLLCDDLALLKEKTLNAGVSEKDYDSFLQYSVQFFGNLGNYVSFGDSK
FVPRLEVSEFEKIVNCVNNEQAVTLFQQVKEPLYSLDTNLLELSFGNSSYYNREVTSHDA
ERVKSFMESNSIAAENTRLFKTGENQFELKIASASPKASTTHTHEDLTITTTYGDFSKEL
AGVRDNLERALPYSANEFQKNMLIKYRQHFDGGDFKDFCDSQIQWVQDKGPIIETNIGFI
ETYRDVLRVRAEFEGFVAVVNRIASMKAQAVVEDAEKFISRLPWNTDKTNGDKKPFEVET
FTKPDFTSLEVLTFTSSGLPAGINIPNQFFIRESHGFKNVSLGNVLNAPTAQGEEITFLN
EEDKKIFKDYKGKAFEIQVLIHELLGHGSGKLMKENDIKGIIHPITKQPITTFYKEGETF
NSVIGEISNAFEECRAECTGIYLCLDREILKICGVEGEEANKIIYANWLLMVRSGLLALQ
FYNPDTKTWNQAHMMARYSILRVLMEAGLVKISKLEDDLQIVFDGSKIETAGKEAIGNYL
LHINVSKATADKADATQLFGKYTAVNEEFVEMRKIVLNKKQPRRVFAQPHTVINKDGKVE
LLNFPATSEGMINAFVAQAKLNQ
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgactattgctcaagttcttcaagatgaaaaattgaaacactttgtttgcccagagaag
gttcctgttactagattggaattggatgaagcttggaatgctttggatgaacaacaaaag
ttgtatgctcactacttttccagagcagctattagtggaacaggaattgttttagggcaa
tgttctgaagaatctccattgatttacaaattgttggttttgctttgtgatgatttggca
ttattgaaggaaaagacattgaatgctggagtgagtgaaaaggactatgattccttcttg
caatattctgtccaattctttggtaatttgggaaattatgtgtcctttggtgacagtaaa
ttcgttccaagattggaggtttcagaatttgaaaagattgttaattgtgtaaataatgaa
caagctgttaccttgttccaacaagttaaggaaccattgtatagtttggatactaattta
ttggaattatcctttggtaactcttcatattataatagagaagtcacttctcatgatgct
gaaagagtcaagtcattcatggaatccaactcaattgctgctgaaaatactagacttttc
aagactggagaaaatcaattcgaactcaagattgcaagtgctagtccaaaggcttccacc
actcacacccatgaagatttgaccattaccactacttatggtgatttcagtaaggaattg
gctggtgttcgtgacaatttggagagagctcttccatattccgcaaacgaattccaaaag
aacatgttaatcaaatatcgtcaacactttgatggaggtgatttcaaagatttctgtgac
tctcaaattcaatgggttcaagataaggggcctattattgaaaccaacattggtttcata
gagacctaccgtgatgttttaagagtcagagcagaatttgaaggatttgttgctgttgtc
aatcgtattgctagtatgaaagcccaagctgtcgttgaggatgctgaaaaattcatttct
cgtttgccatggaatactgacaagactaatggagacaagaagccattcgaagttgaaaca
tttaccaagccagattttactagtttggaggttttgacatttacatcaagtggtttgcca
gctggtatcaatattccaaatcaattctttatcagagaatctcatggtttcaagaatgtt
tctttgggtaatgttctcaatgctccaactgctcaaggtgaagaaattaccttcttgaat
gaggaagataagaagattttcaaggactacaaaggaaaggcatttgaaattcaagtcttg
attcacgaattgcttggtcacggaagtggtaagctcatgaaggaaaatgacattaagggt
attattcacccaattaccaaacaaccaatcactaccttctataaggaaggcgaaactttc
aatagtgtaattggtgaaatcagtaatgcttttgaagaatgtcgtgctgaatgtactggt
atctatttgtgcttggatagagaaatcttaaagatttgtggtgttgaaggtgaagaagct
aacaagattatctatgccaactggttgctcatggttagatctggtttgttagctcttcaa
ttctacaacccagataccaagacttggaatcaagcccacatgatggccagatattcaatt
ctcagagttttgatggaagctggattggttaaaatcagcaagttggaagatgatttacaa
attgtttttgatggtagcaagattgaaactgctggaaaggaagcaattggaaactatttg
ctccatatcaatgtttcaaaggctactgctgacaaggcagatgctactcaactttttggt
aaatatacagctgttaatgaagaatttgttgagatgagaaagattgtcttgaataagaaa
caaccaagacgtgtgtttgctcaacctcatactgtcattaataaggacggtaaggttgaa
ttgctaaacttcccagcaacatctgaaggaatgattaatgcctttgttgcccaagcaaag
cttaatcaataa

DBGET integrated database retrieval system