KEGG   Naegleria gruberi: NAEGRDRAFT_38463Help
Entry
NAEGRDRAFT_38463  CDS       T01241                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
ngr  Naegleria gruberi
Pathway
ngr00010  Glycolysis / Gluconeogenesis
ngr00020  Citrate cycle (TCA cycle)
ngr00620  Pyruvate metabolism
ngr01100  Metabolic pathways
ngr01110  Biosynthesis of secondary metabolites
ngr01130  Biosynthesis of antibiotics
ngr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAEGRDRAFT_38463
   00020 Citrate cycle (TCA cycle)
    NAEGRDRAFT_38463
   00620 Pyruvate metabolism
    NAEGRDRAFT_38463
Enzymes [BR:ngr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     NAEGRDRAFT_38463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_16
Motif
Other DBs
NCBI-GeneID: 8860033
NCBI-ProteinID: XP_002679452
JGI: Naegr1_38463
AA seq 530 aa AA seqDB search
MQQQIIPVLYEQALKHERGTALTCTGALVAFSGQKTGRSPKDKRIVSEETSKDDIWFGPV
NIPLSEDSFMVNRERAVDYLNTREQLYVFDGYAGWDPKYRIKIRVVSTRAYHALFMRNML
IRPTQQELLDFGEPDYVIYNAGEFPANRYTKGMTSSCSISLNFKRREMVILGSQYAGEMK
KGVFTIMHYLMPKQGVLSLHSSCNEGKDGSVSLFFGLSGTGKTTLSADPNRYLIGDDEHV
WTESGVFNIEGGCYAKCIGLKRETEPEIYDALKFGSVLENVMMDEVTRQVEYESSEITEN
TRACYPLEYIPNSKIPAITKHPNNIILLTCDAFGVLPPVSKLNIPQTMYHFISGYTAKVA
GTEVGVTEPQATFSACFGEPFLVLHPTKYAEMLAEKLEQHSATAWLLNTGWVGGSAGSKS
KVRGKRCPLKYTRAIIDAIHNGELVQAPTVEMEIFGLHVPTKCTGVPDDLLLPKNAWSDK
DAYDDELNKLCILFNKNFEAYADRASQQVLAAGPKSTSTKHYDVKLIREA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcagatcataccagtattatatgaacaagcattaaaacatgaaagaggtaca
gcattaacttgtacaggtgcacttgttgcttttagtggacaaaagacaggtcgttcacct
aaagataaacgtattgtttcagaagaaacatcaaaagatgatatttggtttggtcctgtt
aatattccattaagtgaagattcatttatggttaatagagaacgtgctgttgattattta
aatacacgtgaacaattatacgtttttgatggttatgctggttgggatccaaaatataga
attaagattagagttgtttctacacgtgcttatcatgctctattcatgagaaatatgtta
attagaccaactcaacaagaattattagattttggtgaacctgattatgttatttataat
gcaggtgaattccctgctaatcgttatactaagggaatgacatcaagttgttcaatttca
ttaaattttaagagacgtgaaatggtaatattaggatcacaatatgcaggtgaaatgaag
aagggagtatttaccataatgcattatttaatgccaaaacaaggagtactttcacttcat
agtagttgtaatgaaggtaaagatggtagtgtttcattattttttggattatcaggtaca
ggtaaaacaacattatcagcagatcctaatagatatttaattggtgatgatgaacatgta
tggacagaaagtggtgtttttaatattgaaggtggttgttatgctaaatgtattggttta
aagagagaaactgaacctgaaatttatgatgcattgaaatttggttcagttttagaaaat
gtaatgatggatgaagttacacgtcaagttgaatatgaaagttcagaaattacagaaaat
actcgtgcttgttatccattagaatatattccaaattctaaaatacctgccattacaaaa
catccaaacaatatcattttattaacttgtgatgcatttggtgttttaccacctgtttct
aaattgaacattccacaaacaatgtatcatttcattagtggttatactgctaaagtagct
ggtactgaagttggtgttactgaaccacaagctacattctctgcctgttttggtgaacca
ttccttgttttacatccaactaaatatgctgaaatgttagctgaaaaattagaacaacac
tctgcaactgcttggttacttaatactggatgggttggtggtagtgctggttctaaatca
aaggtacgtggtaagagatgtccattaaaatatacacgtgccattattgatgctattcat
aatggtgaattggttcaagctccaactgttgaaatggaaatctttggtttgcatgttcca
actaaatgtactggtgttccagatgatttattattaccaaagaatgcttggtctgataag
gatgcctacgatgatgaattgaacaagttatgtatcttgtttaataagaactttgaagct
tatgctgatagagcttctcaacaagttcttgctgctggtccaaaatctacctccactaaa
cattacgatgttaaactcattcgtgaagcttaa

DBGET integrated database retrieval system