KEGG   Naegleria gruberi: NAEGRDRAFT_47805Help
Entry
NAEGRDRAFT_47805  CDS       T01241                                 

Definition
(RefSeq) rasGEF domain-containing protein
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ngr  Naegleria gruberi
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngr04131]
    NAEGRDRAFT_47805
Membrane trafficking [BR:ngr04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    NAEGRDRAFT_47805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF DOCK-C2 RasGEF_N
Motif
Other DBs
NCBI-GeneID: 8850571
NCBI-ProteinID: XP_002679050
JGI: Naegr1_47805
AA seq 2668 aa AA seqDB search
MSSSSPPPSLNHHQNVEEEIIIRNNPQQEEQQQPLHQHTAAEEQSLCNLNNNNSTTISSS
LPSTTTSNNNNNNIDIDSNNSTANIVSTSQTSSSSSSNNVQINNNLESSSLQQQQQSNID
NNNTITTTTSQIEGTSIELQQQEEEEITSTNNINNNDITTTNTTTTTITNNDEEEKEEQV
ISNPFHLVKDCNELPINERYHSDLRPFLERLEEQPNRFKSIDQETVNMILGDWMVLTMDH
LSNYKQVAPPYLYCKQINNQYQQQSSSSLYENELERHLLMIGNPNRLAMGQLQPQQQPTI
TIGNNNHSNNNIATNASGVGVGGSITTQQQHLTSPSTTANNLNVLSSNELTYSEDIEDDD
EIEELEKTATLSNRKQNQNLLKVAPNSQSDLSNEHFNTQLSKKNVSQGSFNSNLSASYNK
FSLSDQAINLNNSEYNSSIGMPRYTSQPINFTQPRDLFAEKLSKQELITSHQSHSQQHSP
QLNGTTTHDDEEDINSNSEDDSSSIMVLGDNINNINDHFAFSPNTRSMYEDMGKSTVIQL
QGSYRHQTLLDRAVRSSFSSNPYNSPANSRNQMTSSSSNLSPISSKRMTAEMSSQSFTQP
HPERSTIASFEDLGHTRRGSVFGRIDSDDEDEDNPLNNNTASTNTGGDFASPRNHPPTDE
DSFDQSHSNQSKGSRVRSIGHISELNKQKQVNRASFFDFIRRKPKKEFESSTNSLDESTS
YSNNNNNTIGTTGQQTVSMSAGNFSNHHHHDIEKSKMDIISGESVSQLHEQLYGKKKKNE
SVFTKLKAKGIRPKDLKRIEGFKFKENVITQYELENPYRVISYYNNDFIWNGGQEIERCH
RTRKVQPLYNNIDKMMYLIFEYEDFVLSKFGLPEPLFCKVSLYDIKSEVKLTEDFCFFIE
PKHSLSSSDGFSMNKLANSTQRHIKNINKRQNFEKASALFVFEKPEHTEVYISFTIEKVF
CGGLIEDAWKAYKSNNEKLMKKYLTQMNDYWRASMLRQPFIVMGQKIFYENRDENDNSSI
EILEGQVKINKAYRIPSHSSSSFDVLTFLKWLSSNGSTNLPIQGSGGSDFSTTFNMDDDK
NNLPIRFLFQTNTATRDKLASYLHAFSTRKSKASSQQSHTSMRFKNDFSMFKTDQDDHVI
ETVMKRLDKSKGSFSVLDTFYKLFPVVESLHNSKDYYQFDFNLRNTLYIYLDTCELSSLS
KTGNIYIKVSYKKNDMITSTRESRMADSFNDSNRFNYFYSSITFKKISPQFYDEIRLEIP
SSANIVDKSHVLFEFFDLDISKGLDGKAPQNSDMDISSDGITNTQLIGFAYLRDVTNHCI
VKDGYHTLTIFKSPKLVDNYLSLQTDIPMSHSSYLNIKTKALTSFYTQDPFAASFLDACD
RFYNTFESTKKNEDVNREEILLDVMSKLDNLRDANFAELLNHTPKVINGLLTLLSTLVII
KNFNQYGTRTKVIVPEIISRAMSCLLFFLSGIETVSSSFGRNNYYISTFISYFSRQYPDM
EEPLYKMLMDEMLNFIQNWQESRQKDRKKPIIELGVFSPKVSDLNFKPQNGLAKNIDSHK
QISTFLFTSMETRPNGKQAEGQVKEFKDFITRERRKVSNTSSTGSSSGGGSSSKQKQIVI
DDFNTQKIIAEANPRKVSEISFTGVDVIKFGWFFFDLITKNIHIVRDEEFKKVSSQQFDP
NIFMSRLKQLIHTIAPLLLECYEKRFKDAAIYAAATNFNLDFSLFLRDLVPILDFKYIRE
IMIEYFSYFQDKLSNDKTRDVAIFYILQFLELFIEHDDIFFIIQNSENQFIISKLIDCII
YGLTQKTDELKGLSLRILKNHLTKLDFDSRIQSQKDRNFIGNLYFDFVKKVIEQKDSISD
CITFKDELGDLFACFYHILKNSSDEKIVEYFSSLESEKILSLVDILQVTVMLMNIHNQNQ
VQICFHEVYMELFNKIIVNLYLKPKSEIFSEKTNQLLSKFKDLLINHLLGGQGQGGFSDE
TCSMEMKQLIDELTISIYENDSQTLVFYEIFDKSLHFLLSVVLLSPYLDSEHKRVLFQSY
LEPFLETFKPFIFINEHIKLNDININSNNNNNSNNTNNNNGGNNSDVNNSNESNIKLSTT
TTKQFNIPTQLTAKIGMSHLTFDKTHLTQLLSDRNPKWKSILASVLSYCYFPTLTETFSS
VRDVLYDLIEIYQHEQVDSIEDLIQKQQSHKEYLLKLGGTLHVNRDTPHLSVEELEKMNF
SKLENLVEKLFINPNIYTNSLLLSSSNNQVSSPINNNTQSSNSNLQSNISNGSGGANVAN
NNNLDFKLTYAEIFFSSYLFFTTPHQLLLMIRQILFKFAQDPEIEHKSEMVLNITLSIKL
WIEKHFTDMTQPFICNLIQFLDNDLTLVIKQVAFECFYLLEQVKSSLINCLLGIKEQSNE
DSKKKPNPIIPNGFSKLKLNLLTSFVPSFDLLAWNSTEIARQLTLIDFEFFKQIDNKEIC
ASTKQKDYLPHLSSLLERKRDCELWVVTLILRERDLNKRIEIINKFNQICEELFAMNNLF
GLYSIYCGLSNHAILRLNKSWSKESKKIYRLYHETYFSDKNPQARENLINRLNSIKLPII
PLVNSYLDELKECDIEPTFRQSNGTIFINFGKCIKLVEILQHFKSYQEVGYNFESIPYLI
KILCVDVPSDLIQTQSEALELSNQLESE
NT seq 8007 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatcatcacctccaccatcattaaaccatcatcaaaatgttgaggaggaaata
attattcgaaacaatccacaacaagaagaacaacaacagcctttgcatcaacatactgct
gctgaggaacaatctttatgtaatttaaataacaacaacagtactactattagttcttct
cttccatccactaccacttccaataacaataataataatattgatattgatagtaataat
agtactgctaatattgtatcaactagtcaaacatcatcatcctcatcatcaaataatgta
caaattaataataatttagaatcgtcgagtcttcaacaacaacaacaatcaaatattgat
aacaataatactataacaacaacaactagtcaaatagaaggtacatcaattgaacttcaa
caacaagaagaagaggaaattacttctactaataatataaataataatgatattacaacc
actaatactactactactaccattactaataatgatgaagaagaaaaagaagaacaagta
ataagcaatccatttcatcttgttaaagattgtaatgaattaccaattaatgaacgttat
cattcagatttaagaccattcttagaaagattggaagaacaaccaaatagatttaaatca
attgatcaagaaactgttaatatgattctaggagattggatggttttaacaatggatcat
ttatctaattataaacaagttgcaccaccttatttgtattgtaaacaaattaataatcaa
tatcaacaacaatcatcatcatctctttatgaaaatgaattggaaagacatttattaatg
attggtaatccaaatagattagctatgggtcaattacaacctcaacaacaaccaactata
accattggtaataataatcatagtaataataacattgctactaatgctagtggtgttggt
gttggtggttcaataactacgcaacaacaacatttaacatcaccatcaacaactgcaaat
aatttaaatgtgttaagttctaatgaattaacatatagtgaagatattgaagatgatgat
gaaattgaagaattggaaaagacagcaacactttcgaatagaaaacaaaatcaaaattta
cttaaagttgcaccaaattcacaatcagatttatcaaatgaacattttaatactcaattg
agtaagaaaaatgtttcacaaggtagttttaattctaatctaagtgctagttataacaaa
ttttcactttcagatcaagctattaatttaaataattctgaatataatagttcaattggt
atgccacgttatactagtcaaccaattaattttacacaacctagagatttatttgctgaa
aaattatcaaaacaagaattaatcacttcacaccaatcgcattcacaacaacactctcca
caattgaatggtactactactcatgacgatgaagaagatattaatagtaatagtgaagat
gattcatcgagtataatggtattaggtgataatattaataatattaatgatcattttgca
ttttcaccaaatacacgttcaatgtatgaagatatgggtaaatcaacagtgattcaatta
caaggatcttatcgtcatcaaactctattggatagagctgttagatcatcattttcatca
aatccatataattcacctgctaatagtagaaatcaaatgacatcaagttcaagtaattta
agtccaatctcaagtaagagaatgacagctgaaatgagttcacaatcattcactcaacca
catccagaaagaagtacaattgcttcctttgaagatttaggtcatacgagaagaggaagt
gtatttggtagaattgacagtgatgatgaagatgaagataatccattaaataataataca
gcaagtacaaatacaggtggtgattttgcaagtcctagaaatcatccaccaactgatgaa
gattccttcgatcaatcacattcaaatcaatcaaaaggttcacgtgttagaagtattggt
catatttctgaattgaataagcaaaaacaagttaatagagcttcattctttgattttatt
agaagaaaaccaaagaaggaatttgaaagctcaaccaattcactcgatgaatcaacaagt
tattcaaataataataataatactattggtactacaggacaacaaactgttagtatgagt
gctggtaatttctcaaatcatcatcatcacgatattgagaagagtaaaatggatatcatt
tcaggtgaatcagtttcacaacttcatgaacaactctacggaaagaagaagaagaatgaa
tcagtttttacaaaacttaaagctaaaggaattagacctaaagatttaaaaagaattgaa
ggatttaaatttaaagaaaatgtcattacacaatatgaattagaaaatccatatagagta
atttcctattataataatgattttatttggaatggtggacaggaaattgaaagatgtcac
agaactagaaaagttcaaccactctataataatattgataagatgatgtatttaatattt
gaatatgaagattttgtactttcaaaatttggtttacctgaacctttattttgtaaagtt
tcactctatgatatcaaatctgaagttaaattgacagaagatttttgtttctttattgaa
cctaaacattctctatcaagtagtgatggattttcaatgaacaaattggcaaattccaca
cagagacatattaagaatattaacaagagacaaaattttgaaaaggcatctgctttattt
gtatttgaaaaaccagaacatacagaagtttacatttcattcaccattgaaaaggtattt
tgtggaggtttaatagaagatgcatggaaagcctataaatccaataatgaaaagttaatg
aagaaatatctcacacaaatgaatgattattggagagcgagtatgttgagacaaccattc
attgtaatgggtcaaaagattttctatgaaaatcgagatgaaaatgataattcttccatt
gaaatattagaaggtcaagttaaaattaacaaggcctatagaataccatcacattcttca
agttcatttgatgtattaacattcttaaaatggttatcaagtaatggttcaactaattta
cctattcaaggtagtggtggcagtgatttttcaacaacatttaatatggatgatgataag
aataatctcccaattcgtttcctatttcaaactaatacagctacgagagataaattagca
tcctatttacatgccttctccactcgaaaatccaaagcttcctctcaacaatctcatacc
agtatgcgattcaagaatgatttttccatgtttaaaacagatcaggatgatcatgtcatt
gaaactgttatgaaaagattggacaaatcgaagggatcattctctgttctcgatacattt
tacaaattatttccagttgttgaatcacttcataactctaaagattattatcaatttgat
tttaatttaagaaatactttatatatttatttagatacatgtgaattatcttcactttct
aaaactggtaatatttatattaaagtttcatataagaagaatgatatgatcacttcaaca
agagaatctagaatggcagattcatttaatgattctaatagatttaactatttttattct
tcaatcacatttaagaaaatttcacctcaattttatgacgaaattagattggaaattcca
tcatctgccaatattgttgacaagtcacatgttttatttgaattttttgatttggatatt
tcaaaaggtttagatggaaaagctccacaaaatagtgatatggatatttcatctgatggt
attacaaatactcaattaattggttttgcatatttaagagatgttactaatcattgtatt
gtaaaagatggttatcatactttaacaatatttaaatcaccaaaattagttgataattat
ttaagtttacaaacagatattccaatgtcacattcatcttatttaaatatcaaaacaaaa
gcgttaacttctttttatactcaagatccatttgctgcttcattccttgatgcatgtgat
agattttacaatacatttgaatctactaaaaagaatgaagatgttaatagagaggaaata
ttattagatgtcatgtcaaagttagataatttaagagatgctaattttgcagaattattg
aatcacactccaaaagtaattaatggtcttttaactttattatcaacattggttataatt
aagaattttaatcaatatggaactagaactaaggttattgtacctgaaattatttcacgt
gccatgtcatgtttgttattctttttaagtggaattgaaactgtttcttcttcatttggt
agaaataattattacatttcaacttttatttcttacttttcaagacaatatccagatatg
gaagaaccattatacaaaatgttaatggatgaaatgttaaatttcattcaaaattggcaa
gaatcaagacaaaaagatagaaagaaaccaatcatagagttgggagtcttttcaccaaag
gtttctgatctcaattttaaaccacaaaatggtttggcaaagaatattgattcacacaaa
caaatttctacctttttattcacctcgatggaaactagacccaatggaaaacaagcagag
ggtcaagtgaaggaatttaaggattttatcacacgtgagaggagaaaagtatccaacact
tcttcaactggcagcagcagtggtggtggcagcagtagcaaacaaaaacaaattgtcatt
gacgatttcaatactcaaaagattattgctgaggcaaatcctagaaaagtctctgaaatt
tcctttactggagttgatgtaatcaaatttggttggttcttctttgatttgattacaaag
aatattcacattgtgagagatgaggaatttaaaaaggtttcctctcaacaatttgatcca
aacattttcatgagtcgattgaaacaattaattcacaccattgcacctctcctattggag
tgttatgagaagagatttaaagatgcagctatttatgcagctgctaccaattttaatttg
gatttttcattatttttgagagatttagttccaattcttgattttaaatatattagagaa
ataatgattgaatattttagttatttccaagacaagttatcaaatgacaagacaagagat
gttgcaattttctatattttacaatttcttgaattatttattgaacatgatgatattttc
tttattattcaaaattctgagaatcaatttataatttccaaattaattgattgtattatt
tatggtttaacacaaaaaactgatgaattgaaaggtttatcattgagaattttaaagaat
catttaacaaaattagattttgattctagaattcaatcacaaaaagatcgaaattttatt
ggaaatttatattttgattttgttaaaaaagtaattgaacaaaaagattcaatttctgat
tgtattacatttaaagatgaattgggagatttatttgcatgtttttatcacattttaaag
aattcaagtgatgaaaagattgttgaatatttctcttcacttgaatctgaaaaaattctt
tcattagttgacattttacaagtaactgtcatgttaatgaatattcataatcaaaatcaa
gtacaaatttgttttcatgaagtttatatggaattatttaacaagattattgtaaattta
tatttaaaacctaaaagtgaaatatttagtgaaaaaacaaatcaacttttatctaaattt
aaagatttactaattaatcatttattaggaggtcaaggtcaaggaggtttcagtgatgaa
acatgttcaatggaaatgaaacaattaattgatgaattgacaatttcaatttatgaaaat
gattcacaaactttagttttttatgaaatttttgacaagtctttacatttccttttatct
gttgttttattatctccttatttggattcagaacataagagagttttatttcaatcttat
ttagaaccatttttagaaacttttaaaccttttatatttattaatgaacatattaaatta
aatgatattaatattaatagtaataataataacaatagtaataatactaataataataat
ggtggtaataatagtgatgttaataattctaatgaaagtaatattaaactatcaacaaca
acaacaaaacaatttaacattccaacacaattaacagctaaaattggaatgtcacattta
acatttgataaaacacatttaacacaattactttcagatagaaatcctaaatggaaatca
atattagcaagtgtattatcctattgttatttcccaactttgactgaaactttttcaagt
gttcgtgatgtcttgtacgatttgattgaaatttatcaacatgaacaagttgattcaatt
gaagatttaatacaaaaacaacaatcacataaggaatatctattaaaattgggtggtact
ttacatgttaatagagatactccacatttatcagttgaggagttggaaaagatgaatttt
tcaaaattggaaaatcttgttgaaaaattatttatcaatccaaatatttatacaaatagt
ttactgctatcatcatctaataatcaagtatcatctccaattaataacaatactcaatca
agtaatagtaatttacaatcaaatatttcaaatggtagtggtggtgcaaatgttgctaac
aacaataatttggattttaaattaacctatgcagagatattcttttcaagttatttattc
tttacaacaccacatcaattattgctcatgattcgtcagattttatttaaatttgctcaa
gatcctgaaattgaacataagagtgaaatggtgttaaatattacactttcaatcaagttg
tggattgaaaaacatttcacagatatgacacaaccattcatttgtaatttaattcaattt
ttagataatgatttgacacttgttattaaacaagttgcatttgaatgtttttacttgtta
gaacaagttaaatcatcactcattaattgtttattgggaattaaagaacaatccaatgaa
gattctaaaaagaaaccaaatccaatcattccaaatggattttccaaattgaaattgaat
ttactaacttcatttgttccttcatttgatttacttgcatggaattcaactgaaattgca
agacaattaactttaatagattttgaattctttaaacaaattgataataaggaaatttgt
gcatccaccaaacaaaaagattatttaccacatctctcttcactattagagagaaagaga
gattgtgaattgtgggttgtgactttaattttacgtgaaagagatttaaataagagaatt
gaaattattaacaaatttaatcaaatatgtgaagaattatttgccatgaataatttattt
ggattatattcaatatattgtggattgagtaatcatgccattttgagattaaataagagt
tggtcaaaggaatctaaaaagatttatcgtttatatcatgaaacttacttttcagataaa
aatccacaagcaagagagaatttaattaatcgattaaattcaattaaattaccaatcatt
ccattggtaaattcctatttagatgaattgaaagaatgtgatattgaacctacctttaga
caatcaaatggtactatatttattaactttggtaaatgtattaaattggtagagatttta
caacactttaagagttatcaagaagttggatataattttgaatctattccatatttaatt
aagattttatgtgttgatgttccatcagatttaattcaaactcaatcagaagcattagaa
ctttcaaatcaattagaatctgaataa

DBGET integrated database retrieval system