KEGG   Naegleria gruberi: NAEGRDRAFT_61596Help
Entry
NAEGRDRAFT_61596  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
ngr  Naegleria gruberi
Pathway
ngr03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    NAEGRDRAFT_61596
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ngr03021]
    NAEGRDRAFT_61596
Transcription machinery [BR:ngr03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     NAEGRDRAFT_61596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_C RNA_POL_M_15KD tRNA-synt_1f DUF2387 C1_1 Lar_restr_allev OrfB_Zn_ribbon
Motif
Other DBs
NCBI-GeneID: 8864001
NCBI-ProteinID: XP_002683595
JGI: Naegr1_61596
AA seq 143 aa AA seqDB search
MSNNETATTTATGITATKSSDIHFYASKMFCHECGTLLSFPTAPTVTTWACSCCGARFNI
TDYNDVQFSFKMSIPRKSKIAELEERLKEEKSSGNEFSIINEPCPKCHHPQRKFFTMQLR
SADEGQTVFYECLKCGFKERVNN
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacaacgaaaccgctaccaccactgccactggcataacagcaactaaatcttcc
gacattcatttctatgcttcaaaaatgttttgccacgaatgtggtacattattgtctttt
ccaacagctccgacagtaacaacatgggcttgttcatgttgtggtgctagatttaatatt
actgactataatgatgttcaattttctttcaaaatgtccatcccgagaaaatcaaagatt
gcagaattagaagaaagattaaaggaagaaaagtcttcgggtaatgaattttctatcatc
aacgaaccatgtccaaaatgtcatcatcctcaaagaaaattctttacaatgcagttacgt
tcggctgacgaaggtcaaactgtattttatgaatgtctaaagtgtggatttaaggaaaga
gtgaacaattaa

DBGET integrated database retrieval system