KEGG   Naegleria gruberi: NAEGRDRAFT_69820Help
Entry
NAEGRDRAFT_69820  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
ngr  Naegleria gruberi
Pathway
ngr00600  Sphingolipid metabolism
ngr01100  Metabolic pathways
Module
ngr_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    NAEGRDRAFT_69820
Enzymes [BR:ngr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     NAEGRDRAFT_69820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat PH FAM195
Motif
Other DBs
NCBI-GeneID: 8851893
NCBI-ProteinID: XP_002675073
JGI: Naegr1_69820
AA seq 560 aa AA seqDB search
MTQQAAEEEITLVVNDNDSGVVAVEDQQHSEQQKQLTAIDNYSLNNNDQNLIGFKPITLD
SNLRYRNKKFKAELNGDFLILRNLEGKKSNDNLVPLLTIEMESIFAVHKKTDQPLVFVVF
TFRAKDCKKIVYEFEALGNEECAEWVDSIRSNAFKTNLIMSGSKSFGNRRVLLFINPFSG
KKTGTKIFEKQIKPMLDVAHLSYDAIITERADHAFEFCSTSDKILEYTDICGMGGDGIIY
EIINGIGKRKDWKNVFDRVRIGHIPGGTSNALAVFSGSQVKSGKPAVPEMAAFIIARGFH
QPMDLLSCFQEANKRYISFLSITWSAIADVDIGTENMRWLGAARNTVGAIKQIMNKKAYR
GKLKYVQQSQELKRVKSLKNIRENEQRYSSYTESSIEFLQGKENEKGQLSCPLLEQYFHE
EFKKLAPEYCSEKEPNITEDSTNSHLEVKEIEDRFCMFLAANISHISFDFIASPMAHHHD
GYIDLVYVKDDISRGDFLNIFLAAEKGDHIFEKCVDLSKVKAFMLTPIDTGSFVVVDGEA
VDYSPILVEVHPSCCKLLTL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacaagcagcagaagaagaaatcacactcgttgtgaatgacaatgattcggga
gttgtagctgttgaagatcaacaacattccgaacagcaaaaacaattaaccgccattgat
aattattctcttaataataatgatcagaacctcattggattcaagccaattacattagat
tccaacctccgatatcgaaataagaaattcaaagcagagttgaatggtgattttctgata
ttgcgaaatttggagggaaagaagagcaacgacaatttggtgcctctcttgacgattgaa
atggaatctatatttgctgttcataagaaaacggatcaacctcttgtgtttgttgtgttt
acatttagggcaaaggattgtaagaagattgtttatgaatttgaggctttggggaatgaa
gaatgtgcagagtgggttgatagtattagatcgaatgcttttaaaactaatttaatcatg
tcgggatctaaatcatttggaaatcgtagagttttgctttttattaatccattcagtgga
aagaagactggaaccaagatttttgagaaacaaatcaagccaatgcttgatgttgctcat
ctttcatatgatgcaattattacagagagggcagatcatgcatttgagttttgttctacc
tctgataagattttggaatatacagatatttgtggaatgggaggagatggtattatttat
gaaataatcaacggaattggaaagagaaaggattggaagaatgtatttgatcgtgtcagg
attggtcatattccaggaggaacttccaatgctttggctgtattttctggatctcaagtt
aaaagtggaaagccagcagttcctgaaatggccgcctttattatcgccagagggttccat
caacctatggatcttttatcctgttttcaagaggccaataagagatacatctcattcctg
agtattacttggagtgctattgcagatgtggatattggcactgaaaatatgagatggctg
ggtgcagccagaaacacggtcggagctatcaaacaaattatgaacaagaaggcatacaga
ggaaagcttaaatatgttcaacaatctcaagaattgaaacgtgtaaaatctctgaaaaac
attcgagagaatgaacaaaggtattcatcctatacagagagtagtattgaatttttacaa
ggaaaggaaaatgaaaagggtcaactaagttgtccactcttggaacaatatttccatgag
gaatttaagaaattggctccagaatattgttctgaaaaggaaccaaatatcactgaggat
tccaccaattctcacttggaagtcaaagaaattgaggacagattttgcatgttcctggcc
gccaatatttcacacatttcctttgatttcattgcctcaccaatggctcaccatcatgat
ggttacattgatttggtctatgtgaaggatgacatttcaagaggagatttcctcaatatc
tttttggcagcagagaagggagatcatatttttgaaaagtgtgttgatttgtcgaaagtg
aaggcattcatgcttacaccaattgatactggatcgtttgttgttgtggatggagaggct
gttgattatagtccaatacttgtagaggttcatccttcttgttgtaaacttttaactttg
taa

DBGET integrated database retrieval system