KEGG   Naegleria gruberi: NAEGRDRAFT_70090Help
Entry
NAEGRDRAFT_70090  CDS       T01241                                 

Definition
(RefSeq) tyrosine decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ngr  Naegleria gruberi
Pathway
ngr00350  Tyrosine metabolism
ngr00360  Phenylalanine metabolism
ngr00380  Tryptophan metabolism
ngr01100  Metabolic pathways
ngr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NAEGRDRAFT_70090
   00360 Phenylalanine metabolism
    NAEGRDRAFT_70090
   00380 Tryptophan metabolism
    NAEGRDRAFT_70090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngr04147]
    NAEGRDRAFT_70090
Enzymes [BR:ngr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     NAEGRDRAFT_70090
    4.1.1.105  L-tryptophan decarboxylase
     NAEGRDRAFT_70090
Exosome [BR:ngr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NAEGRDRAFT_70090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase SepSecS Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 8862660
NCBI-ProteinID: XP_002674785
JGI: Naegr1_70090
AA seq 544 aa AA seqDB search
MLPSNNQQPLPSQENNNSSSEFTLEELNFQHPWSASDFKNHLNTVGDYIVNYHDQLINPN
NTLEENKIHHPVCSQVQPGYLQKLLPNEAPLNGESFDDILKDVSEKITMGVTHWQHPNFY
SFFSANFSYPALIGDILSGMFNVIGFSWITSPACTELETIVMDWLAKALHLPKHFLSETT
GGGSIQDTASSAGVVAMLAAKEKKRVQMKNEMGDSFNQADFQGKLVAYVSSQTHSSIEKA
CMVTGIIHLRKISAYPDTYNMNENELEKTIQQDLENGLIPFFVCGTIGTTSSTAIDDLSK
IGAICQKFSLFLHVDAAFVGSSLMLPECRQAFVGGDNCEYLEFADSFTFNPHKWMLTNFD
CCAFWVKERKHLKNALSLDPEYLKNKASSSGLVTDYRDWQLPLGRRFRSLKLWLVMRVYG
ISGLQKYLRHHINLTKYAETELRKQSCIEFLAPRVTSLICFRYHNSEWSLQKENRFNEIL
IERINVNGMMYMSHTVLGGKYCLRLAICGSFTNLEHVQFALSTIDSQMKNLLADLENGTV
EINI
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgcttccatcaaacaatcaacagccactcccatcacaagagaataacaattcatcatcg
gaatttacacttgaagaactcaattttcaacatccatggtctgcctccgatttcaaaaat
cacctaaatacagttggtgattatattgttaattatcatgatcaattaattaatccaaac
aatactttagaagaaaacaaaattcatcacccagtctgttctcaagtacaaccaggttat
ttgcaaaaattattaccaaatgaagcacctcttaatggagaatcatttgatgatattttg
aaagatgtttctgagaagattactatgggagtaactcattggcaacatcctaatttctat
tctttcttttctgccaatttttcatatcctgctctcattggtgacatcttgtcaggaatg
ttcaatgtcattggttttagttggattacttcacctgcatgcacagaattggaaactatt
gttatggactggttggccaaagctctccatttaccaaaacactttttaagtgaaacaaca
ggtggaggatccattcaagatacagcttcatcagctggtgtagttgcaatgttagcagct
aaagaaaagaaacgtgtccaaatgaagaatgaaatgggtgattcattcaatcaagctgat
tttcaaggaaagttagtggcctacgtttcaagtcaaactcacagctctattgagaaggca
tgcatggtcactggtattattcatttgaggaaaatatctgcctatccagacacttataat
atgaatgaaaatgaattggaaaaaactattcaacaggatttggaaaatggtttaattcca
ttctttgtttgtggaaccattggaacaacaagtagcactgccattgatgatttatccaag
attggagcaatttgtcaaaagttttcattattccttcatgttgatgctgcattcgttgga
tcatcactcatgctacctgaatgtagacaagcttttgttggtggtgataattgtgaatat
ttggaatttgctgattctttcacattcaatcctcacaagtggatgttgacaaactttgat
tgttgtgcattttgggtcaaggagagaaaacatttgaagaatgctctgtctttagatcct
gaatatttgaaaaataaggcatccagtagtggacttgttactgattacagagattggcag
ttgcctcttggtagacgtttcagatctttgaaattgtggcttgttatgagagtttatggt
attagtggacttcaaaagtatctcagacatcacattaatcttacaaaatatgccgaaact
gaattgagaaagcaatcatgcattgaattcctagctccaagagttaccagtcttatctgt
ttcagatatcacaattcagaatggtctctccaaaaggaaaatcgtttcaacgagattctt
attgaaagaattaatgtaaatggtatgatgtacatgagtcatactgttttgggtggaaag
tattgtttgagattggcaatttgtggttccttcacaaatctcgaacatgtccaatttgct
ctctcaaccattgacagtcaaatgaagaatttattggcagacttggaaaatggaactgtt
gaaatcaatatttaa

DBGET integrated database retrieval system