KEGG   Naegleria gruberi: NAEGRDRAFT_71631Help
Entry
NAEGRDRAFT_71631  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K09564  peptidyl-prolyl isomerase E (cyclophilin E) [EC:5.2.1.8]
Organism
ngr  Naegleria gruberi
Pathway
ngr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    NAEGRDRAFT_71631
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ngr03041]
    NAEGRDRAFT_71631
   03110 Chaperones and folding catalysts [BR:ngr03110]
    NAEGRDRAFT_71631
Enzymes [BR:ngr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     NAEGRDRAFT_71631
Spliceosome [BR:ngr03041]
 Complex B
  Other components
   Prp19-related factors
    NAEGRDRAFT_71631
 Complex C
    NAEGRDRAFT_71631
Chaperones and folding catalysts [BR:ngr03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    NAEGRDRAFT_71631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 RRM_7 Limkain-b1
Motif
Other DBs
NCBI-GeneID: 8854854
NCBI-ProteinID: XP_002673159
JGI: Naegr1_71631
AA seq 173 aa AA seqDB search
MEQHQMLQNLLKEKKNLSSTTAHALNSYRKVLYVGNLSQQVTRDVLYNLFIPFGEVLEVT
VPVNQVNKEEKGFSGANTKHRGYAFVEFELPEDATDALENLNNGELFGRIITVNYSKATN
LSREAFSDLNVPLWSLNESSESNNNNTESSSDSNEPNVAVLETEPSLKKTKLS
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacatcaaatgttgcagaatttgttgaaggagaagaagaatctctcatcaaca
acagcacacgccttgaattcatatagaaaagtattatatgttggaaatttatcacaacaa
gtcactagagatgtattatacaatttatttattccattcggagaagtattggaagtaaca
gtgcctgttaatcaagtcaacaaggaggaaaagggattttcaggtgcaaatactaaacat
cgtggatatgcttttgtagaatttgaacttccagaggatgccacagatgctctagagaat
ttaaataatggtgaattatttggaagaattataacagttaattattcaaaagctacaaat
ctttccagagaagccttttctgatctcaatgttccactgtggagtttgaatgaatcatct
gaatcaaataataataatactgaatcatcgagtgatagcaatgaacctaatgttgcagtt
ttggaaacagaaccatctttaaaaaagactaaactttcataa

DBGET integrated database retrieval system