KEGG   Naegleria gruberi: NAEGRDRAFT_71748Help
Entry
NAEGRDRAFT_71748  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ngr  Naegleria gruberi
Pathway
ngr03040  Spliceosome
ngr04141  Protein processing in endoplasmic reticulum
ngr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    NAEGRDRAFT_71748
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NAEGRDRAFT_71748
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    NAEGRDRAFT_71748
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngr01009]
    NAEGRDRAFT_71748
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ngr03041]
    NAEGRDRAFT_71748
   03009 Ribosome biogenesis [BR:ngr03009]
    NAEGRDRAFT_71748
   03110 Chaperones and folding catalysts [BR:ngr03110]
    NAEGRDRAFT_71748
   04131 Membrane trafficking [BR:ngr04131]
    NAEGRDRAFT_71748
   03051 Proteasome [BR:ngr03051]
    NAEGRDRAFT_71748
   03029 Mitochondrial biogenesis [BR:ngr03029]
    NAEGRDRAFT_71748
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngr04147]
    NAEGRDRAFT_71748
Protein phosphatases and associated proteins [BR:ngr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     NAEGRDRAFT_71748
Spliceosome [BR:ngr03041]
 Complex B
  Other components
   Prp19 complex
    NAEGRDRAFT_71748
 Complex C
   Prp19-CDC5 complex
    NAEGRDRAFT_71748
Ribosome biogenesis [BR:ngr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    NAEGRDRAFT_71748
Chaperones and folding catalysts [BR:ngr03110]
 Heat shock proteins
  HSP70 / DNAK
   NAEGRDRAFT_71748
Membrane trafficking [BR:ngr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    NAEGRDRAFT_71748
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    NAEGRDRAFT_71748
Proteasome [BR:ngr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    NAEGRDRAFT_71748
Mitochondrial biogenesis [BR:ngr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    NAEGRDRAFT_71748
Exosome [BR:ngr04147]
 Exosomal proteins
  Proteins found in most exosomes
   NAEGRDRAFT_71748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl PCI
Motif
Other DBs
NCBI-GeneID: 8854435
NCBI-ProteinID: XP_002673288
JGI: Naegr1_71748
AA seq 569 aa AA seqDB search
MIIATDYLPNLVREDRYWFGIDFGNSFIKVSSDICSGCLGENVIRLGSNVDTVIVCMMES
KIKRFELFGFEESDEEYIDFTIVNIKRLIDCLGSDQDQLNEIKILENDEIEGEKRLISQI
FTENVHIKSKDDVENLNKLIQIKITDTKTNYSIEIPLFTLMVKLFDKLRVEILGKDMGKD
LFERNIITVPVFYNDLQLTFLKSAFEMAGFKVERAIKDVIAAGLAYSINNKTDRDLLILN
CGSTCTIATLYNLEEGIFELIEYTSDSTISGNSIDELLVNYCVQEFKKKTKKQLTNPKAR
ARLYEVCKLAKEELYGERNLLNVLIQVDSLMDGVDFSLVLSKPKFEQLVTPVVSKITSLL
NSLLERNSKSIHSVSDLILCGACCQISKFSSTIREFFKGNNQFVLYDNIPPKTIKARGAT
VFCEQFRVRNTFWAHVVLPLSIGIEHNRKMMILAHRNTYLPYKKSFTVQKNVNPSTNQFH
FKLYMGERYIPRNNLLLGEFCIPNLNETSDKTVLREFKLDVSISYEEILFLTIQEATSIQ
EYHFEADWTQLTRELVEESARLGELDKSS
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgataatagcaactgattatttgccaaatcttgtacgagaggatcggtactggttcgga
attgatttcggaaattccttcatcaaggtttcgagtgatatttgctcgggttgtttggga
gagaatgttattagattgggttctaatgttgatacggttattgtttgtatgatggagagt
aaaattaaacgatttgaattgtttggttttgaagagagtgatgaggaatatattgatttt
acaattgtaaatattaagagattaattgattgtttgggatcggatcaagatcaattgaat
gaaatcaagattttggaaaatgatgaaattgagggagagaagagattaataagtcaaata
tttactgagaatgtacatatcaaatcgaaagacgatgtagagaatttaaacaagttgatt
cagattaagattactgatacgaaaactaattattcaattgagattccactatttacccta
atggtgaaattatttgataaattgagagtggaaatattgggaaaggatatgggaaaagat
cttttcgaacgaaatattattacagttccagtattttacaatgatttacaattaacgttt
ttaaaaagtgcttttgaaatggcaggatttaaagtggaacgagcaattaaagatgtgata
gctgctggattggcatatagcatcaataacaagacggacagagatttgttaattttgaat
tgtggatctacatgtacaatagcaacactatacaatttggaagaaggtattttcgagttg
attgaatacacttcagatagtaccatttcaggaaattctattgatgagctattggttaac
tattgtgtgcaagaatttaaaaagaaaacaaaaaagcagcttacaaatccaaaggcaaga
gccagactttatgaggtatgtaaacttgccaaagaagaattatacggcgaaagaaatcta
ctcaatgttttgattcaggtagattccttgatggatggagttgatttctctttagtcctc
agcaaaccaaaatttgaacaattagtaacaccagtagtctcaaaaattacatccctactg
aactctctattggaaaggaattcaaaatcaattcattctgtcagtgatttgattttatgt
ggtgcttgttgtcaaatctcaaaattttcatctacaatccgagaattcttcaaaggaaat
aatcaattcgttttatacgacaacattcctccaaaaaccattaaggcaagaggagctacc
gtattttgtgaacagttcagagttagaaatactttttgggcacacgttgtgttgccactt
agcattggaattgaacataataggaaaatgatgattctggcccataggaatacttacctg
ccttacaagaaatcgttcactgtacaaaagaatgtcaacccatccacaaaccaattccat
ttcaaattgtacatgggtgaaagatacataccgaggaataatttattattgggagaattt
tgtattcctaatttgaatgaaaccagtgataaaactgttttgagagagtttaagctggat
gtctcaatttcttatgaagaaattctcttcctaaccattcaagaagcaacaagtattcaa
gaatatcattttgaagcagattggactcaactcacacgagaattagtagaagaaagtgca
agattgggagagttggataaatcttcatga

DBGET integrated database retrieval system