KEGG   Naegleria gruberi: NAEGRDRAFT_72810Help
Entry
NAEGRDRAFT_72810  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
ngr  Naegleria gruberi
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngr01001]
    NAEGRDRAFT_72810
Enzymes [BR:ngr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     NAEGRDRAFT_72810
Protein kinases [BR:ngr01001]
 Serine/threonine kinases: Other
  CAMKK family
   NAEGRDRAFT_72810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 8853537
NCBI-ProteinID: XP_002672135
JGI: Naegr1_72810
AA seq 283 aa AA seqDB search
MGIIATKDDSGISNETRQKRSSKSVFEKRDGLVTIDTSLTVTSSTPTPTTTEKRSRSSTL
PVSNLFSSRREDNEDDAFSKMYVNKGMKNNASPHSPNRSSSGRLQIGSSLGKDSPSEDAY
SPIFGSTNDSVTKLTNSLLLSSDEEGNKMINEYTVISTLGKGSYGKVKLVLDNNNKPFAM
KIMNKAMLKRVKKAGGGNLLMDVQREIAIMKKLSHQNVVRLFEVIDDRNSDFLYLLIEYA
ENGAILSMSETNTGEEVPKPCKFRLNQIRSYLKQAIEGVQYLQ
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcatagcaacgaaggacgatagtggtatatccaatgaaactcgtcaaaaacga
tccagcaaaagtgtatttgaaaaaagagacggacttgtaactatagacacttcactgacc
gtaacaagttcaacaccaacacctacaacaacagaaaagagatcaagaagttcaacactt
ccagtttctaaccttttttcaagtagaagagaagataacgaagatgatgcattctctaaa
atgtatgtcaacaagggtatgaaaaataatgcctctcctcattctccaaacagaagtagt
tcgggaagattgcaaataggatcatctcttggaaaagactctccgagtgaggacgcttat
tcaccaatatttggatcaaccaatgattcagttaccaaactcacaaattcactacttttg
agctctgacgaagaaggtaataagatgattaacgaatatacagttatctctacattggga
aagggatcatacggaaaagttaaattagttttggataataataacaaaccttttgcgatg
aaaattatgaacaaggccatgttgaaaagagttaaaaaagctggtggtggaaacttgcta
atggacgttcaaagagaaattgcaattatgaaaaaactttctcatcaaaacgtagttaga
ttattcgaggttattgatgatagaaattctgatttcctttatttattaatcgaatatgca
gaaaacggagcaattttatccatgtcagaaactaacactggagaagaagttccaaaacct
tgtaaattcagactcaatcaaattagatcatatttgaaacaagctattgaaggagttcag
tatcttcagtaa

DBGET integrated database retrieval system