KEGG   Naegleria gruberi: NAEGRDRAFT_73130
Entry
NAEGRDRAFT_73130  CDS       T01241                                 

Definition
(RefSeq) ERG4/ERG24 ergosterol biosynthesis protein family protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ngr  Naegleria gruberi
Pathway
ngr00100  Steroid biosynthesis
ngr01100  Metabolic pathways
ngr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    NAEGRDRAFT_73130
Enzymes [BR:ngr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     NAEGRDRAFT_73130
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 8858129
NCBI-ProteinID: XP_002671837
JGI: Naegr1_73130
AA seq 393 aa
MEQSEVTIAYFNNGLDVLSMLSRWQVPSSESVMIFMSSVLFCIVATLVLPGKMVQGVPLK
DGSRITYKINGLSVVLLGTLFYGLLCYFNFQIGNELIYSLVCKSFGQLLVTSLVFSFLLT
SFLNLRCVLQPERSNYVYPKWNIIMNFWCGVELNPHIFGFEIKQFSYRPAFLMIGILNLS
FAFEQFRLYQTLSQNFITFQIISFLYLIDCFVFEEGLIFMFDIIEENFGFMLVFGDYMWT
PFIFTLQNLYLINDFNVNHFQTVANILIFIVGYIIFRGANNQKITFRQDPKQVWLGLIEP
KVLETSRDRKLLISGFWGMARKINYLGDILVAISQSFPCLQCGHVLPWMYPIYLTPLLLH
RAMRDNERCKEKYGKFWDEYCSKVRWVMIPGIY
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggaacaatcggaagtgaccattgcatactttaataatggccttgatgtgctgagtatg
ttgagtaggtggcaagtaccaagctcggaatctgtcatgattttcatgtcaagtgttttg
ttttgcattgtggcgacattggttcttcctggaaagatggttcagggagttccattgaag
gatggatcgaggattacatacaagattaatggattatcggttgtgttgcttggaacttta
ttttatggattgttgtgctatttcaatttccaaattgggaatgagcttatttattcattg
gtttgtaagagttttggacaattgctggttacaagtttggtgtttagttttctattgacc
agtttcttaaatttgagatgtgtccttcaaccagagagaagtaattacgtttatcctaaa
tggaatattatcatgaatttttggtgtggtgttgaattgaatccacacatttttggattt
gaaattaagcaattttcgtatagacctgcattcttaatgattggaattttgaatttaagt
tttgctttcgaacagtttcgtctctatcaaacactttctcaaaatttcataactttccaa
atcattagtttcctctacttgattgattgtttcgtatttgaagaaggactcattttcatg
tttgatattattgaggaaaactttggattcatgttagtttttggtgattacatgtggact
ccatttattttcacacttcaaaatttatatttgattaatgactttaatgttaatcatttc
caaacagttgccaatattttgatattcattgttggttatatcatctttagaggagccaat
aatcaaaaaattaccttccgtcaagatccaaaacaagtttggcttggactaatcgaacct
aaagtattggaaacttctcgtgatagaaagctgctcatttctggattctggggaatggcc
agaaagattaattatttaggagatatcctagtggccatctctcaaagtttcccatgtctt
caatgtggccatgtccttccatggatgtatccaatttatttaacaccacttttacttcac
agagccatgagagataatgaaagatgtaaggaaaagtatggaaagttttgggatgaatat
tgttcaaaggttaggtgggttatgattcctggaatttattag

DBGET integrated database retrieval system