KEGG   Naegleria gruberi: NAEGRDRAFT_77798Help
Entry
NAEGRDRAFT_77798  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ngr  Naegleria gruberi
Pathway
ngr00450  Selenocompound metabolism
ngr00970  Aminoacyl-tRNA biosynthesis
ngr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NAEGRDRAFT_77798
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NAEGRDRAFT_77798
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ngr01007]
    NAEGRDRAFT_77798
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ngr03016]
    NAEGRDRAFT_77798
Enzymes [BR:ngr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     NAEGRDRAFT_77798
Amino acid related enzymes [BR:ngr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   NAEGRDRAFT_77798
Transfer RNA biogenesis [BR:ngr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NAEGRDRAFT_77798
 Prokaryotic type
   Other AARSs
    NAEGRDRAFT_77798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 8857533
NCBI-ProteinID: XP_002683222
JGI: Naegr1_77798
AA seq 487 aa AA seqDB search
MLSSSSEKKVPVPVPGQRNILITSALPYVNNYPHLGNIVGAVLSADVFSRYCKQKGYNTL
YICGTDEYGTATETKAFQEKTTPEAICAKYYQLHKQVYEWFDIDFDHFGRTSTKQQTEIA
QDIFLKLHQNGFLTEKTIEQLYDEESKTFLADRFVKGTCPTCLYEDARGDQCDKCGKLLN
PTELINPRSTTTGSVPIIKETNHIFIKLQDLQHKTKEWFQNNKDTAQWTTVARSITQSWF
DKGLEERCITRDLKWGTPVPLEKFADKVFYVWFDAPIGYISITADQGGHKIGEPVGLIRK
IEDAEIKEWKKRFGGGEDEIFQLDLRVGQIESVELHPEADKLYVFNVKIADTVTRKIVGG
LREAYPESETLIGKKVVVACNLAVAKLKGVESEGMLLASKQNDGVTSLLTPSGEAPLGAQ
IYPKGAAFKPEKVLKKNPTKIILDSIKIGENNVPLYKNLPLVVFDSQKKVIAQVATEKDI
AQGSGVF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgtcatcatcagaaaagaaggttccagtgccagtgcctggacaaagaaatatt
ttaattactagtgctttaccctatgttaataactatcctcacttgggaaatattgttggt
gctgttttgagtgctgatgtattttctcgttattgtaaacaaaaaggatacaatactctt
tatatttgtggtaccgatgaatatggtactgcaacagaaacaaaggctttccaagaaaag
actacaccagaagccatttgtgctaaatattatcaacttcacaaacaagtttatgaatgg
tttgatattgattttgaccacttcggaagaactagtacaaagcaacaaacagaaattgct
caagacattttcttaaaacttcatcaaaatggatttttgactgaaaagactattgaacaa
ttatatgatgaagagagtaagacatttttggctgatagatttgtcaaaggtacttgtcca
acttgtttatatgaagatgctcgtggtgaccaatgtgacaaatgtggaaaattgttgaat
cctactgaacttattaacccacgttcaacaactaccggttctgtaccaatcatcaaggaa
acaaatcacattttcatcaagttacaagatttgcaacacaaaacaaaggaatggttccaa
aataataaggatactgctcaatggactacagttgctcgttcaattactcaatcttggttt
gataagggacttgaggaaagatgtattaccagagatttaaagtggggtactcctgttcca
cttgaaaagtttgcagacaaggttttctatgtctggtttgatgctccaattggttacatt
tctatcactgctgatcaaggaggtcacaagattggtgaaccagttggtttgattagaaag
attgaagatgctgaaattaaggaatggaaaaagcgttttggaggtggtgaagatgaaatc
ttccaattggatttgcgtgttggtcaaattgaatccgttgaattacacccagaagctgac
aagttatatgtctttaatgtaaagattgctgacactgtaactagaaagattgttggtggt
ttgagagaagcttatccagaatctgaaaccttaattggtaagaaggttgttgttgcttgc
aatttggctgttgctaaattgaagggtgttgaaagtgaaggtatgctcttggcctctaag
caaaatgatggagtgacctcattgctcacaccttcaggagaggctccacttggtgctcaa
atttatccaaagggtgctgctttcaaaccagaaaaggtgttgaagaagaatccaacaaag
attattttggattctatcaagattggtgaaaataatgtcccactctataagaatttacct
ttggttgttttcgatagtcaaaagaaggtaattgctcaagttgctactgaaaaggacatt
gctcaaggaagtggtgttttctaa

DBGET integrated database retrieval system