KEGG   Naegleria gruberi: NAEGRDRAFT_78168Help
Entry
NAEGRDRAFT_78168  CDS       T01241                                 

Definition
(RefSeq) tripeptidylpeptidase II
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
ngr  Naegleria gruberi
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ngr01002]
    NAEGRDRAFT_78168
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ngr03110]
    NAEGRDRAFT_78168
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     NAEGRDRAFT_78168
Peptidases and inhibitors [BR:ngr01002]
 Serine peptidases
  Family S8: subtilisin family
   NAEGRDRAFT_78168
Chaperones and folding catalysts [BR:ngr03110]
 Intramolecular chaperones
  Subtilisin family
   NAEGRDRAFT_78168
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII
Motif
Other DBs
NCBI-GeneID: 8850025
NCBI-ProteinID: XP_002682099
JGI: Naegr1_78168
AA seq 1306 aa AA seqDB search
MPQSEYPVEGLNPKSEVQGLEFLKLYPNYDGRGVRVAIFDTGIDIGAPGLNGLTTDGKRK
IIDVVDCTGSGDVDTKTIVNPDANGIVIGKTGRKLKIDAKWKELNSSNEYHVGIKSVFEL
YPKPLIDRVKEERKKQFQKKQTEKVNEIKEKSNLLKNSTDEKSKKELSELEKQLDLLNDL
MKNYEDSGPLLDCIVFLDEKANVYRAVVVHDSYDAEKNIFETSSFDEQVVDLSNEKLMSD
YSLNYEYSTFTELDLLNYSFKIYDNGNLLSIVTTSGSHGSHVAGIVGAHFPDKPELNGAA
PGCQIVSCKIGDNRLGSMETGTALNRGLISCYENKCSIINMSYGEPSSLANTGIFREKLE
ELVYNHNVTFVTSAGNAGPNYTTCGAPASLSDSCIGVGAYVTQSMIKAQYGLSETVPDSQ
FTWSSRGPTEDGQLCPTISSLGAAITSVPNYTLQSVNRCNGTSMSSPQCSGCLALLYSAL
IAEGRKWNPYYIKKVLENTARNNHENDEKNVDEHSHHPLSIGSGLVQVLDAFKFIEKQKP
FNPDTDDYRYVISIPQRNNARGIYLREFEETHSTQFYTVSIDLVYNEKTKNMSKIEFEKR
FKLVPIFSSNNANTVTDHKANETPKFIKAPEFLHIPGTFSFVVQINTEILDENNVYFARI
DALDCDNMEFGPVFSVPITVMKPYKLVKSDTEVEYRKTFTYQMKSGELYRQYISTPSCSI
QYCKLSLRADEMDTQKMLVFHATQLLDREAYSKYDTRKFIQVSQSDVSTHNIKTVPNRTL
ELTFGQFWSSPGQCKITVDVEFYGIDSINISNDEIFFDGSEVARKIQLTSSLRNMEMNIS
AKLDSWKETLSPTNSEDSKLIQIQNNPRNTYFDTEKCSYEMILDYNLKMASDHEIITSLP
VLSKLLYECNIESRMLMIFNKNKKLVKVSDYHPEKFKLKKGDYVVRAQFRHDNIATLQKL
KNYPLVITHVLAKPISLKLFKHINGALTDVDKQDEKFKLSYGRSNSYALGYSGVEKDLPK
EVKAGDRLTGKFQYQGVDVATVPLTFVVPPSFLASEKSTPEKENKADERTAEQKFQDYII
EQQVTYLKKLKAEALPFVNTLLENNPKYLGLLLLKLDILKEQLKTSTEKKDLVNQITQLV
DSVTEVANISDLIIHYGSQPKNKTKNEDEESELEQQAYQLKCKEMDKKKDALINSLQTKL
DLLLDDTTGSEISDRDTLIKQTMKTLRQFVDPTEKFLFTDVQYDLYFKYQTVALQKLIKS
LGEQNENESKLYDLISKLTGEMGFNHWSTLLKNNKKMRFPDSYTLF
NT seq 3921 nt NT seq  +upstreamnt  +downstreamnt
atgccacaaagtgaataccctgttgaaggtcttaatccaaagagtgaagttcaaggcctt
gaatttttaaaactttatccaaactacgatggtagaggagtaagagttgcaatatttgac
actggaattgatatcggagctccaggtttaaatggcttgacaacggatggtaaaagaaaa
atcattgatgttgttgattgtacaggatccggtgatgtagataccaaaactattgtcaac
cctgatgcaaatggaattgttattggaaagacaggaaggaaattaaaaattgatgcaaaa
tggaaggaattaaatagttccaatgagtatcacgttggtataaagagtgttttcgaattg
tatcccaaaccattgattgatagagttaaggaagaaagaaaaaaacaattccaaaagaaa
caaacagagaaagtgaatgaaattaaggaaaaatctaatttattgaaaaattctaccgat
gaaaaatcaaagaaggaactttcagaattagaaaaacaactcgatttattgaacgattta
atgaagaattatgaagactctggtccacttttggattgtattgtatttttagacgagaag
gccaacgtgtatagagctgtggttgttcatgatagttatgatgctgagaagaatattttt
gaaacctctagttttgatgaacaagttgtcgatttgagtaatgaaaagttgatgagtgac
tatagcctgaattacgaatattccaccttcacagaacttgatttattgaactattctttc
aagatttatgataatggtaacttgctttctattgttactacctcaggatctcacggctca
cacgttgcaggaattgttggcgctcacttcccagataaaccagaattgaacggtgcagca
cctggttgccaaattgtttcatgcaaaattggtgataatagattgggttctatggaaact
ggaacagctctcaatagaggcttaatttcctgctatgaaaataagtgttccattattaat
atgtcatacggcgagccaagctctcttgctaacactggtatctttagagaaaagttggaa
gaattggtttacaatcacaatgttacatttgtcacctcagctggtaacgctggaccaaac
tatacaacttgtggtgcccctgcttccttatctgactcatgtataggtgttggagcttat
gtaacccagtctatgataaaagctcagtatggactttctgagacagttccagattcccaa
tttacatggtcttccagaggtccaacagaggatggtcaattgtgcccaactatttctagc
ttgggtgctgctattaccagtgtaccaaactatactctacaatctgtaaatcgatgtaat
ggaacttccatgtcttcacctcaatgttccggttgtcttgcattgctttatagtgcctta
atagctgagggaagaaaatggaatccttattacatcaaaaaagttttggaaaatactgca
agaaataatcatgaaaatgatgaaaagaatgtggatgagcatagccatcatccattatct
attggttcaggattagttcaagttttggacgcctttaaatttattgaaaagcaaaagcca
ttcaatccagacactgacgattatagatatgtaatttcaattccacaaagaaataatgca
agaggcatttatttaagagaatttgaggagactcactcaacccaattctatacagtcagt
attgatcttgtctacaatgagaaaacaaagaatatgagcaagatcgagtttgaaaagaga
ttcaaacttgtacctattttttctagcaataatgcaaatacagtcacagatcacaaagca
aatgagactccaaaattcatcaaagcaccagaattcttacacataccaggaacattctca
ttcgttgttcaaattaatactgaaattttagacgaaaataatgtttattttgccagaatt
gatgctcttgattgtgataatatggaattcggtccagttttctctgttccaattactgta
atgaaaccttacaagctagtcaaatctgataccgaagtagaatatagaaagactttcacc
tatcaaatgaaatcaggagaactctatagacaatatattagcaccccttcatgctctatt
caatactgcaagttatcattgagagctgatgaaatggacacacaaaaaatgctcgtcttc
catgctacacaacttttggacagggaagcctattctaaatatgacaccagaaaattcatt
caagtttctcagtcagatgtttccactcacaatattaagactgttccaaatagaactcta
gaattgacatttggtcaattctggtcctctcctggacaatgtaaaattacagttgatgta
gaattctatggaatcgactctatcaatatttccaatgatgagatattctttgatggaagt
gaagttgctagaaagatacaactcacttcatcattaagaaatatggaaatgaatatttct
gcaaaacttgattcttggaaagaaacactctctccaaccaatagtgaagattcaaaactc
attcaaattcaaaacaatccaagaaatacctattttgatactgaaaagtgtagctatgaa
atgatacttgactataatctcaagatggcatcagatcatgaaattatcacctcactacca
gttctctccaaattactctatgaatgcaatattgaatcaagaatgcttatgatcttcaat
aagaataagaaattagtcaaggtttctgattaccatcctgaaaaattcaagttgaagaag
ggtgactatgttgtcagagcacaattcagacatgacaatattgcaaccctacaaaagctc
aagaattatcctctcgtcattactcacgtacttgccaaaccaatttcactcaaattattc
aagcacatcaatggtgctcttactgatgttgataaacaagatgaaaaattcaagttgagt
tatggtagaagcaattcctatgccttgggatattctggagttgaaaaggatttaccaaag
gaggttaaggctggcgatagattgactggtaaattccaatatcaaggtgttgatgttgcc
actgttccacttacctttgtggttccaccttctttcttggcaagtgaaaaatcaactcct
gaaaaggaaaataaggctgatgaaagaacggcagaacaaaagttccaagactacattatt
gaacaacaagtaacctatcttaaaaagctcaaagctgaagctttaccatttgtcaacaca
cttttagagaacaatccaaagtatttgggacttcttctattgaagcttgatattctcaag
gaacaactcaagaccagcactgaaaagaaggatctcgtcaatcaaattactcaacttgtt
gatagtgtcactgaagtcgctaacatttctgatttgattattcactatggtagtcaacca
aagaataagacaaagaacgaagatgaagaatctgaactcgaacaacaagcataccaactc
aaatgtaaagaaatggataagaagaaggatgcactcattaattcattgcaaaccaaactc
gatttgttgttagatgatacaactggctcagaaatttcggacagagatactctaatcaag
caaacaatgaagaccctcagacaatttgttgatccaacagagaaattcctcttcacagat
gtccaatatgatttatactttaaatatcaaacagttgcccttcaaaagttgattaaatca
ttgggagaacaaaatgaaaatgaatccaaattgtatgatctcatatccaagctcactgga
gagatgggattcaaccattggtccactctcttgaaaaataataagaagatgagattccca
gacagttatacccttttctaa

DBGET integrated database retrieval system