KEGG   Naegleria gruberi: NAEGRDRAFT_83269Help
Entry
NAEGRDRAFT_83269  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
ngr  Naegleria gruberi
Pathway
ngr00360  Phenylalanine metabolism
ngr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ngr00790  Folate biosynthesis
ngr01100  Metabolic pathways
ngr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    NAEGRDRAFT_83269
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NAEGRDRAFT_83269
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NAEGRDRAFT_83269
Enzymes [BR:ngr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     NAEGRDRAFT_83269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT
Motif
Other DBs
NCBI-GeneID: 8858574
NCBI-ProteinID: XP_002672482
JGI: Naegr1_83269
AA seq 449 aa AA seqDB search
MERVFPKFANATKLHKTLLLSLPHKVTSLTSSLAVFSKHNVNLIKIESRPNRFDKKVIDF
VVNVDEGVSKDIVDRAIKEMVQEKICDHVQYLGFENKIPWFPTKIADIDHFARECLEAGA
VLQADHPGFHDQEYRDRRKMIADIALNYKHGSPIPRIDYTETENKTWSIIYKKLTALYPK
YACEQYNNLFPLFEQNCGFKEDKIPQLQDVSDFLLSSTGFRIRPVSGLLTSRDFLNALAF
RVFHSTQYIRHHSKPYYTPEPDVVHEMLGHMPLLADSDFAEFSQQIGLASLGASDEEIDR
LVRLYWYCLEFGILKENGSLKAYGAGLLSSFGELEYGCSGIDAETGKKPEYLPFVPEDAA
NRVYPITHYQPIYYVVESLESCKDLIRRYVNNSLDRPFQLKYNPYTSTVDVLDSQEKLIS
LTKTIQNNMDLLKSSLSKIGRSYEINNKK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtgtttttccaaagtttgcaaatgcaaccaagttgcacaaaactctccttctc
tcccttccacataaagtcacttcattaacaagttctttggctgtgttttcaaagcacaat
gttaatttgataaagattgaatcacgtcctaatcgatttgataagaaggttattgatttt
gttgtcaatgttgatgaaggagtgagtaaggatattgttgatagagccatcaaggaaatg
gttcaagaaaagatttgtgatcatgtacaatatttgggatttgaaaataagattccttgg
ttcccaacaaagattgcagatattgaccatttcgcaagagaatgtcttgaagctggtgct
gttttgcaagctgatcatccaggtttccatgatcaagaatacagagatcgtagaaagatg
atcgcagacattgctttgaattacaaacatggaagtccaattccacgtattgattacact
gaaactgaaaataagacttggagtattatttacaagaaattgacagctctctatcctaaa
tatgcttgcgaacaatataacaacttgttcccattatttgaacaaaactgtggtttcaag
gaagataaaatcccacaattacaagatgtcagtgactttttgttgagctcaacaggtttc
agaattagacctgtctctggtttgctcacttcaagagatttccttaatgctcttgctttt
agagttttccacagtacccaatatattagacatcacagtaagccatactatacaccagaa
cctgatgttgttcacgaaatgcttggtcacatgccattattggctgattctgattttgct
gaattctctcaacaaattggtcttgcatctctcggagcttccgatgaagaaattgacaga
cttgttagactctactggtactgtctcgaatttggtatcctcaaggaaaacggttccttg
aaggcttatggtgctggtttgttaagctcgtttggtgaactagaatatggttgttcaggc
attgatgcagaaactggaaagaaaccagaatatttaccattcgttccagaagatgctgct
aatagagtttatccaatcactcactaccaaccaatctattatgttgttgaaagcttggaa
tcatgcaaagatttaattagaagatacgtcaacaattctctcgatagaccattccaactc
aaatataatccatacacaagtactgtagatgttttggattctcaagaaaaattaataagc
ttgacaaaaaccattcaaaacaacatggatctgttaaagtcttccctttcaaagattggt
cgttcctatgaaattaacaataaaaaataa

DBGET integrated database retrieval system