KEGG   Nocardiopsis gilva: CDO52_06670Help
Entry
CDO52_06670       CDS       T05022                                 

Gene name
mca
Definition
(GenBank) mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
ngv  Nocardiopsis gilva
Brite
KEGG Orthology (KO) [BR:ngv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CDO52_06670 (mca)
Enzymes [BR:ngv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     CDO52_06670 (mca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: ASU82507
UniProt: A0A223S358
Position
1408602..1409480
Genome map
AA seq 292 aa AA seqDB search
MSERLRLMAVHAHPDDESSKGAATMARYVSEGAEVLVVTLTGGERGSILNPAMDRPEIVA
NIGEVRRKEMAEARQILGVHQEFSGFVDSGLPEGDPLPPLPEGCFALQPLDVASEPLVRS
VRSFKPHVMITYDENGGYPHPDHIMTHKVSVEAFDAAGDPERYPEAGDPWQPLKLYYHVS
FPRVRFEALSQMLDERELENPYKEWMKRIDERKWPEWEITTQVRCDEHFETRDRALIAHA
TQIDPNGFWFAVPMDVQREAWPYEDYHLARSLVDTDIPEKDLFAGVREAVRA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgagcgcttgcggctgatggccgttcatgcccaccctgatgatgagtccagcaaa
ggcgccgccacgatggcacgctacgtcagcgaaggcgccgaagtgctggtcgtcacactg
accggaggagaacgcggctccatcctcaaccctgccatggaccgcccggagatcgtcgcc
aacatcggcgaggtccgccgcaaggagatggccgaggcacgccagatcctcggcgtccac
caggagttcagcggcttcgtcgactccggcctgcccgaaggcgacccactgcccccgctc
cccgagggctgcttcgcgctgcagccgctcgacgtggcctccgaaccgctggtccgctcc
gtgcgctccttcaagccgcacgtgatgatcacctacgacgagaacggcggctacccgcac
cccgaccacatcatgacccacaaggtctcggtcgaggccttcgacgccgcgggcgacccc
gaacgctaccccgaggccggcgacccgtggcagcccctcaagctctactaccacgtctcc
ttcccccgggtccggttcgaggccctctcccagatgctcgacgagcgggagctggagaac
ccctacaaggagtggatgaagcgcatcgacgagcgcaagtggccggagtgggagatcacc
acgcaggtccgctgcgacgagcacttcgagacccgcgaccgcgccctgatcgcgcacgcc
acccagatcgaccccaacgggttctggttcgccgtgccgatggacgtccagcgcgaggcc
tggccgtatgaggactaccacctcgcacggtccctcgtggacaccgacatcccagagaag
gacctgttcgcaggggtccgcgaagcagtgagagcatag

DBGET integrated database retrieval system