KEGG   Nocardiopsis gilva: CDO52_09090Help
Entry
CDO52_09090       CDS       T05022                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ngv  Nocardiopsis gilva
Pathway
ngv00260  Glycine, serine and threonine metabolism
ngv01100  Metabolic pathways
ngv01110  Biosynthesis of secondary metabolites
ngv01120  Microbial metabolism in diverse environments
ngv01130  Biosynthesis of antibiotics
ngv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ngv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDO52_09090
Enzymes [BR:ngv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CDO52_09090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_3 Cys_Met_Meta_PP Repressor_Mnt
Motif
Other DBs
NCBI-ProteinID: ASU82923
UniProt: A0A223S469
Position
complement(1934817..1935842)
Genome map
AA seq 341 aa AA seqDB search
MIDLRSDTVTKPTPEMRRAMAEAEVGDDVFGEDPTIRALEEETARLLGKEQALYVPSGHM
ANQIAVYVSARSGEEIWAHATSHLLGNEQGASSVLARVLPRTFDSPDAVPDTALLERWSA
GIDDVHRARPALLCLENTFTGVVIPLSEQRRVTAFAHSHGMRTHLDGARLWNAAAALGVA
PAEVTEGFDTVSTCFSKGLGAPVGSAVAGDADTIQRARRARKLLGGGMRQAGIIAAGALY
ALRNNVERLADDHSRAARLAKGITSTTGLAAEARTNMVLVETAPSEAHDYAAAFAEQGVG
CVAIGPDLIRLVVHLEIGDADIDAAIARIGAAVAARGGAVE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccttcgttcggatacggtcaccaagcccacccccgaaatgcgacgggccatg
gcggaggctgaggtcggcgacgacgtcttcggcgaagaccccacgatccgcgcgctcgaa
gaggagaccgcgcgactgctcggcaaggagcaggcgctctacgtcccctccggccacatg
gccaaccagatcgcggtgtacgtctcggcacgcagcggtgaggagatctgggcacacgcc
accagccacttgctcggcaacgagcagggggccagctcggtcctggcgcgggtcctgccc
cgaacgttcgactcgcccgacgcggttcccgacaccgcgctgctcgaacgctggagcgcc
gggatcgacgacgtgcaccgcgcccgccccgccctgctctgcctggagaacaccttcacc
ggcgtggtcatcccgctgtccgaacagcggcgggtcaccgccttcgcccactcccacggc
atgcgtacccacctcgacggcgcgcggctgtggaacgctgcggcggcgctgggtgtcgcc
cccgccgaggtgaccgaaggcttcgacacggtctccacctgcttctccaaggggctgggt
gcccccgtcggttcggcggtggcgggcgatgccgacacgatccagcgggcccgccgcgcc
cgcaagctactcggcggcgggatgcgccaggccgggatcatcgcggcgggcgcgctgtac
gcgctccgcaacaacgtcgagcgtctggccgatgaccacagccgggcggcacgcctggcc
aagggcatcacctcgacgacgggcctggccgccgaggcccggaccaacatggtcctggtg
gaaaccgccccaagcgaggctcacgactacgcggcggccttcgccgagcagggtgtcggg
tgcgtggcgatcggccccgatctcatccgcttggtggtccacctcgagatcggtgacgcc
gacatcgatgccgcgatcgcgcggatcggtgcggctgtcgcggcgcggggtggcgcagtc
gagtga

DBGET integrated database retrieval system