KEGG   Nocardiopsis gilva: CDO52_20410Help
Entry
CDO52_20410       CDS       T05022                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ngv  Nocardiopsis gilva
Pathway
ngv00010  Glycolysis / Gluconeogenesis
ngv00053  Ascorbate and aldarate metabolism
ngv00071  Fatty acid degradation
ngv00280  Valine, leucine and isoleucine degradation
ngv00310  Lysine degradation
ngv00330  Arginine and proline metabolism
ngv00340  Histidine metabolism
ngv00380  Tryptophan metabolism
ngv00410  beta-Alanine metabolism
ngv00561  Glycerolipid metabolism
ngv00620  Pyruvate metabolism
ngv00625  Chloroalkane and chloroalkene degradation
ngv00903  Limonene and pinene degradation
ngv01100  Metabolic pathways
ngv01110  Biosynthesis of secondary metabolites
ngv01120  Microbial metabolism in diverse environments
ngv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ngv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDO52_20410
   00053 Ascorbate and aldarate metabolism
    CDO52_20410
   00620 Pyruvate metabolism
    CDO52_20410
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CDO52_20410
   00561 Glycerolipid metabolism
    CDO52_20410
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDO52_20410
   00310 Lysine degradation
    CDO52_20410
   00330 Arginine and proline metabolism
    CDO52_20410
   00340 Histidine metabolism
    CDO52_20410
   00380 Tryptophan metabolism
    CDO52_20410
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CDO52_20410
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CDO52_20410
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CDO52_20410
Enzymes [BR:ngv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CDO52_20410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASU84844
UniProt: A0A223S9N3
Position
complement(4547107..4548528)
Genome map
AA seq 473 aa AA seqDB search
MRSLYLNGAWTGSASSESVDVVNPATEDVIASVPAGHPADVDQAVAAATDAFGPWAALPV
AERRAHLARALDLLKKRADDLAALIVTDLGAPLTLASRVHTGVPLVMFETFLDVADEVGE
RYFTGEKVGTSLVVREPIGVVGAITPWNYPLLQVVLKVVPALLAGNTLVLKPSEVAPLSA
SFLAEAFDDSGLPPGVFNLVSGTGPVVGEAIAAHPGIDMVSFTGSTRAGTRVGELAAATV
KKVALELGGKSPNVILPDADLGAAVKRGVADVMRNSGQSCDALTRMVVPRSRYEEAVRLA
AEATEKYVPGDPLDAGTRLGPLVSAAQRRRVRDYIRVGVQEGARLVTGGAEPPEGIERGY
YVRPTIFADVRNDMRIAREEIFGPVLALIPYDSEEEAVQIANDTDYGLAAAVWAADAERG
LAVARRLRAGQVEVNGGGFNPRAPFGGYKRSGVGREWGLHGLEEFCEVKAIQL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcgatccctgtacctcaacggcgcctggaccggatcggcctcctccgagtccgtcgac
gtcgtcaaccccgcgaccgaagacgtcatcgcctcggtcccggccgggcaccccgccgat
gtcgaccaggccgtggccgcggccaccgacgccttcggcccctgggccgcactccccgtc
gccgagcgccgcgcccacctcgcccgcgccctggacctgctcaagaagcgcgccgacgac
ctcgccgccctcatcgtgaccgacctgggcgccccgctgacgctggcctcccgcgtgcac
accggggtgccgctggtgatgttcgagaccttcctcgacgtcgccgacgaggtgggcgag
cgctacttcaccggagagaaggtcggcacctcgctggtcgtccgcgaaccgatcggtgtg
gtcggcgccatcaccccgtggaactaccccctgctccaggtcgtgctcaaggtggtcccc
gcgctgctggccgggaacaccctcgtgctcaagccgagcgaggtcgccccgctcagcgcc
tccttcctcgccgaggcgttcgacgactccggactgccgcccggcgtgttcaacctcgtc
tccggcaccggcccggtcgtcggggaggcgatcgccgcccaccccggcatcgacatggtc
tccttcaccggatccacccgcgccgggacccgggtgggcgagctggccgccgcgaccgtc
aagaaggtcgcgctggaactcggcgggaagtcccccaacgtgatcctgcccgacgccgac
ctgggcgccgccgtcaagcggggcgtcgccgacgtcatgcgcaacagcgggcagagctgc
gacgccctcacccgcatggtcgtcccccgttcccgctacgaagaggcggtgcggctggcg
gccgaggccaccgagaagtacgtccccggcgaccccctcgacgcgggcacccggctcggg
ccgctggtctccgcggcgcagcgcaggcgtgtccgcgactacatcagggtcggcgtgcag
gagggcgcgcggctggtcaccggtggggccgagcccccggagggcatcgagcgcggctac
tacgtgcggccgacgatcttcgccgatgtgcgcaacgacatgcgcatcgcccgcgaggag
atcttcggcccggtcctcgcgctgatcccctacgactcggaggaggaggccgtgcagatc
gccaacgacaccgactacgggctcgcggccgcggtgtgggccgccgacgccgagcgcggg
ctggcggtcgcgcggcggctgcgcgccgggcaggtcgaggtgaacggcggcggcttcaac
ccgcgcgcgcccttcggcggctacaagcggtccggtgtcggacgggagtggggactccac
ggcctggaggagttctgcgaggtcaaggccatccagctgtag

DBGET integrated database retrieval system