KEGG   Nocardiopsis gilva: CDO52_26375Help
Entry
CDO52_26375       CDS       T05022                                 

Definition
(GenBank) haloacid dehalogenase type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
ngv  Nocardiopsis gilva
Pathway
ngv00361  Chlorocyclohexane and chlorobenzene degradation
ngv00625  Chloroalkane and chloroalkene degradation
ngv01100  Metabolic pathways
ngv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ngv00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CDO52_26375
   00361 Chlorocyclohexane and chlorobenzene degradation
    CDO52_26375
Enzymes [BR:ngv01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     CDO52_26375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like Hydrolase_6 HAD UBA_4
Motif
Other DBs
NCBI-ProteinID: ASU85857
UniProt: A0A223SCI1
Position
6031903..6032580
Genome map
AA seq 225 aa AA seqDB search
MTTARRPHVVAFDVMETLFPLTPLEWRFREAGVPRVLMHRWFAHVLRDAFALTAAGDYRP
FGDLARGALQDITGHQVSAAAVESIVQALASLDVRPDADAAVRRIRDAEVRVVALTNSSE
ENARSLLDRAGLAVHMEHVLSAGKLRRFKPAPEPYHYAAEVCEVEPDRMAMVTCHAWDVH
GAHRAGLVTGWSDHLEGRFPSVFAAPDVTGRGLVPVATDLLELPD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacagccaggcgtccacacgtcgtcgcgttcgacgtcatggagaccctgttcccg
ctcacgccactggagtggcggttccgcgaggcgggggtcccccgggtgctgatgcaccgc
tggttcgcccacgtgctccgcgacgcgttcgcactgaccgcggcgggcgactaccggccc
ttcggtgacctggcgcgcggcgcactgcaggacatcaccggccaccaggtctcggcggcg
gccgtggaatcgatcgtgcaggcgctcgcctcgctggacgtccggccggacgccgacgcc
gcggtgcggcggatccgtgatgccgaggtgcgcgtggtcgcgctgaccaactcgtcggag
gagaacgcccgctccctgctcgaccgggccgggctcgccgtccacatggagcacgtgctc
tcggccggcaagctgcgccggttcaaacccgcccccgagccctaccactacgccgcggag
gtgtgcgaggtcgagcccgaccgcatggccatggtgacgtgccacgcctgggacgtgcac
ggcgcccaccgggccggactcgtcaccgggtggtccgaccacctggagggccgcttcccc
agcgtcttcgcggcgcccgacgtgacgggccggggactggtcccggtggccaccgacctg
ctggagctgcccgactga

DBGET integrated database retrieval system