KEGG   Nitrobacter hamburgensis: Nham_0051Help
Entry
Nham_0051         CDS       T00348                                 

Definition
(GenBank) Phosphopantothenate-cysteine ligase / Phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00770  Pantothenate and CoA biosynthesis
nha01100  Metabolic pathways
Module
nha_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:nha00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Nham_0051
Enzymes [BR:nha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Nham_0051
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Nham_0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein YjeF_N ASFV_J13L RHH_1
Motif
Other DBs
NCBI-ProteinID: ABE60952
UniProt: Q1QS45
Position
56591..58030
Genome map
AA seq 479 aa AA seqDB search
MASLTVRKLDDAIKAELRLRAARNGRSVEDEVRVILREAATVTSSTVATGNRAARNAAIP
AGRNSFHQSNGLRNITLIIGGGIAAYKALDLIRRLKERGFIVRCVMTNAAQQFVTPLSAG
ALAGTHAYTDLFDPGSEFDAGHIRLARDCDLIVVAPATADLMAKMAHGLASDLATAILLA
ADKPILLAPAMNPLMWNNPATRRNVAQLARDGVAMIGPNAGKMAEAGEAGVGRMAEPTEI
ATAAARILGPARPQPLEGKRVLVTAGPTREPIDPVRYIANRSSGKQGFAIAAAAQAAGAE
VTLISGPVDLDDPAGVTVAHVESAREMLAAVEAALPADIAIFTAAVADWRVAHEGAQKLK
KTAAGMPPLQLVENPDILATISKLRDTRPPLVIGFAAETEHLIDNARAKFARKGCDWMVA
NDVSPGTGVMGGDRNTVHLLTRDGVGDEIKAESFPVMTKEDVAAMLIERIVSTVTDQPT
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggccagtctcaccgtccgcaaactcgacgacgccatcaaggccgagctgcgactgcgc
gccgcccgcaacggccgttcggtcgaggatgaggtccgcgttatcctgagggaggcggca
accgtcacgtcctcgaccgtcgccacgggcaatcgcgccgcccgcaatgcagcaatccca
gccggccgaaattcattccatcagtccaatggcttgcgtaacataacgctgatcatcggc
ggcggtattgccgcctacaaggcgctcgatctgatccggcggctgaaggagcgcggcttt
attgtgcggtgcgtcatgacgaatgctgcgcagcaattcgtcaccccgctgagcgccggc
gcgctggccggcacccacgcctacaccgacctgttcgatcccggcagcgaattcgatgcc
ggccatatccggctcgcgcgcgactgcgacctgatcgtggtggcgcccgccaccgccgac
ctgatggcaaagatggcgcacgggttggcctccgatctcgccaccgcgatcctgctcgcc
gccgacaagccgatcctgctggcgccggcgatgaacccgctgatgtggaacaacccggcg
acacgccgcaacgtggcgcagctcgcgcgcgacggcgtcgcgatgatcggccccaatgcc
ggcaagatggcggaagccggcgaggccggcgtcggccgcatggccgagccgacggagatc
gcgacagcggccgcgcggattctcggacccgcgcgaccgcaaccgctcgagggcaagcgt
gtgctggtcacggccggtccaacccgcgagccgatcgatccggtgcgctatatcgccaac
cgttcttccggcaagcaggggtttgccattgctgcggcggcgcaggcggccggggccgag
gtgacgctgatttcggggccggtcgatctcgacgatcccgcaggcgtcacggtggcgcac
gtcgaatcggcgcgagagatgctggcggcggtcgaagcggcactgcccgccgacatcgcg
atcttcacggccgcggtcgccgactggcgggtcgcccacgaaggcgcgcagaaactgaag
aagaccgcggccgggatgccgccgctgcaactggtcgagaaccccgacattctggcaacg
atctcgaagctgcgcgacacgcgtccgcctctcgttatcggtttcgccgccgaaaccgag
catctcatcgacaacgccagggcaaaattcgcgcgcaagggctgcgactggatggtcgcc
aacgacgtctcgcccgggaccggcgtgatgggcggcgatcgcaacacggtgcatttgctg
acgcgtgacggggtcggcgacgagatcaaggccgagtcctttcccgtcatgaccaaggaa
gatgttgccgcaatgctgatcgaacgcatcgtctcgaccgtgacggatcagccgacatga

DBGET integrated database retrieval system