KEGG   Nitrobacter hamburgensis: Nham_0063Help
Entry
Nham_0063         CDS       T00348                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00260  Glycine, serine and threonine metabolism
nha00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nha01100  Metabolic pathways
nha01110  Biosynthesis of secondary metabolites
nha01130  Biosynthesis of antibiotics
nha01230  Biosynthesis of amino acids
Module
nha_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nham_0063
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nham_0063
Enzymes [BR:nha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nham_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABE60964
UniProt: Q1QS33
Position
complement(74997..76241)
Genome map
AA seq 414 aa AA seqDB search
MNSLPNSFRSGPDARGHFGIFGGRFVAETLMPLILDLEKAYTEARADAAFQRDMAGYRKD
YIGRPSPLYFAERLTEHLRDISAASGRAGGAKVYLKREELNHTGSHKVNNVLGQILVARR
MGKKRIIAETGAGQHGVATATLCARFGLECVVYMGAVDVARQEPNVIRMEMLGAKVVPVQ
SGTRTLKDAMNEALRDWVTNVHNTFYCIGTVAGPHPYPMMVRDFQSIIGDETRAQMQEAE
GRLPDSLIACIGGGSNAMGLFHPFLDDSSVEIFGVEAAGHGLDKLHAASLTGGRPGVLHG
NRTYLLMNDDGQIQDAHSISAGLDYPGIGPEHSWLHETGRVTYLSATDEEALSAFQLLSR
LEGIIPALESAHAIARVVELAPERPKDHLMVVNLSGRGDKDVPQVGDILKGRRK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaattctctccccaattccttccgctccggtcccgatgcgcgcgggcacttcggcatt
ttcggcggccgcttcgtcgcggaaacgctgatgccgctgatcctcgatctggagaaggcc
tatactgaggccagggccgatgccgcgttccagcgcgacatggccggctatcgcaaggac
tacatcggccgtccgtcgccgctgtatttcgccgagcgtctgaccgagcatcttcgggac
atctccgcggcttccggccgcgccggcggcgcgaaggtctacctcaagcgcgaagagctc
aatcacaccggttcgcacaaggtcaacaatgtgctcggccagattctggtggcgcggcgc
atgggcaagaagcggatcatcgccgagaccggtgccggccagcacggcgtggcgaccgcg
acgctatgcgcgcgcttcggtctcgaatgcgtggtctacatgggcgcggtggacgtggcg
cggcaggagcccaacgtcatccgcatggaaatgctgggcgccaaagtggtgccggtgcag
tccggtacccgcacgctgaaggatgcgatgaacgaggcgctgcgcgactgggtcaccaac
gtgcataacaccttctattgcatcggcacggtggcggggccgcatccctatccgatgatg
gtgcgcgacttccagtcgatcatcggcgacgagacgcgcgcacagatgcaggaggccgag
ggacggctgccggattcgctgatcgcctgcatcggcggcggctccaatgcgatgggactg
ttccatcccttcctcgacgattcctcggtggagattttcggcgtcgaggcggcgggccac
ggcctcgacaagctgcacgcggcctcgctcaccggggggcggcccggcgtgctgcacggc
aaccgcacctatcttttgatgaatgacgacggccagatccaggacgcgcattcgatttcc
gcaggattggattatcccggcatcgggccggaacattcatggctgcacgaaaccggccgc
gtgacatatctttccgcgaccgacgaggaagcgctcagcgcgtttcagttgctgtcgcgg
ctggagggcatcatcccggcgctggaatcggcgcatgcgatcgcgcgcgtcgtcgaactc
gcgcccgaacggccgaaggatcacctgatggtggtcaatctctcgggccgcggcgacaag
gacgtgccgcaggtcggcgatatcctgaagggcagaagaaagtga

DBGET integrated database retrieval system