KEGG   Nitrobacter hamburgensis: Nham_0128Help
Entry
Nham_0128         CDS       T00348                                 

Definition
(GenBank) pantothenate kinase
  KO
K00867  type I pantothenate kinase [EC:2.7.1.33]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00770  Pantothenate and CoA biosynthesis
nha01100  Metabolic pathways
Module
nha_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:nha00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Nham_0128
Enzymes [BR:nha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     Nham_0128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRK AAA_18 CoaE
Motif
Other DBs
NCBI-ProteinID: ABE61029
UniProt: Q1QRW8
Position
144237..145193
Genome map
AA seq 318 aa AA seqDB search
MDLRAEQQQYNPYRIFSRSEWAKLRDDMPMTLAADEIAALRSMHDRLDLTEVEEIYLPLS
RLLSIYVASMQRLFVAQRRFLGIQDRKVPYIIGVAGSVAVGKSTTARVLQALLARWSPGP
KVDLITTDGFLFPNAVLERHGLMQKKGFPESYKLPMLLAFLSDIKAGRAPVRAPVYSHLT
YDIVPKSWIEVSQPDILIVEGVNVLQTGRLPRDGRAVPVVSDFFDFSVYLDAEEPVLRDW
YVKRFLALRDTAFHDPRSYFHRYALLSDDEATATAIAIWERTNRANLEDNILPTRPRATL
ILKKGADHVVEQVALRRL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggatttgcgagccgaacagcagcaatataatccgtaccggattttctcccgttccgag
tgggcgaagttacgcgacgacatgccgatgacgctggctgcggacgaaatcgcggcattg
cggtcgatgcatgatcgcctcgatctcactgaggtcgaagagatttatttgcctttatcc
agactgctctcgatctatgtggcgtcgatgcagcggctctttgtcgcccagcgaaggttt
ctcggtatccaggatcgcaaggtgccgtatatcatcggcgtggccggctccgttgcggtc
ggaaaatcgaccacggcccgcgtgctgcaggcgctgctcgcacggtggtctccaggcccc
aaggtcgatctcatcaccaccgacggctttctgtttccgaacgcggtgcttgagcgacat
ggcttgatgcagaaaaaaggttttccggagagttacaaactgccgatgctgctggcgttt
ctcagcgacatcaaggcgggccgcgcgccggtgcgcgcgccggtttactcgcatctgacc
tatgacatcgtgcccaagagctggatcgaggtcagtcaacccgatatcctgattgtcgaa
ggcgtcaacgttttgcagaccggtcggctgccgcgcgacggcagggccgttccggttgtt
tccgacttcttcgacttctcggtctatctcgacgccgaagaaccggtgctgcgcgactgg
tacgtgaagcgcttcctcgccctgcgggatacggccttccacgacccgcgatcctacttt
caccgctacgcgctgctgtcggacgacgaggcgaccgcaacggccatcgcaatctgggaa
cgcaccaaccgcgcgaatctcgaggacaacatcctgccgacacggccgcgggcgacgctg
attctcaaaaagggagccgaccatgtcgtcgagcaggtcgcgctaaggcggctttaa

DBGET integrated database retrieval system