KEGG   Nitrobacter hamburgensis: Nham_0223Help
Entry
Nham_0223         CDS       T00348                                 

Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
nha  Nitrobacter hamburgensis
Brite
KEGG Orthology (KO) [BR:nha00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Nham_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ABE61123
UniProt: Q1QRM4
Position
243972..244490
Genome map
AA seq 172 aa AA seqDB search
MRVKAGLKPLCFDAFSLCEPVPILGSRPRPCFARKRYRESPMYRAVTRQIEVTVEPNFMP
ERSSAERGHFFWAYTVVITNAGPDTVQLRTRHWIITDASGRKQEVRGEGVVGEQPVLAPG
ERFEYTSGVPLPTATGFMSGRYQMISIRSGEPFEIDVPTFSLDSPDSKRVLN
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcaaagccgggctcaagcctttatgttttgacgcgttttctttatgcgaaccg
gtaccgatcctcgggtcacgcccgaggccatgcttcgctcgaaaacgctatagagagtct
ccgatgtatcgtgccgttacccgccagatcgaagtcaccgtcgagccgaacttcatgccg
gagcggtcgtccgccgagcgaggccattttttctgggcctataccgtggtcatcaccaac
gccgggccggataccgttcagttgcgcacccggcactggatcatcaccgatgcctcggga
cggaagcaggaagtccgcggcgagggcgtggtcggcgaacagccggtgctcgcgcccggc
gagcgcttcgaatataccagcggcgttccgctgccgaccgccaccgggttcatgagcggc
cgctaccagatgatctcgatccgaagcggcgagccgttcgaaatcgatgttcccaccttc
tcgctcgacagccccgacagcaagcgcgtgctgaactga

DBGET integrated database retrieval system