KEGG   Nitrobacter hamburgensis: Nham_1464Help
Entry
Nham_1464         CDS       T00348                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00500  Starch and sucrose metabolism
nha01100  Metabolic pathways
nha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nham_1464
Enzymes [BR:nha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Nham_1464
Exosome [BR:nha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nham_1464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase Glyco_hydro_70 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ABE62286
UniProt: Q1QNB1
Position
complement(1658203..1660353)
Genome map
AA seq 716 aa AA seqDB search
MIELSSEARAIVEGRHSDPFHYLGRHRENDRQVVRAYLPEASDVRVVDEHGGETTLTRIH
DAGLFLGDLPNGAKRYRLRARFGADTVELEDPYRFPPILSDFDLYLLGEGTDQRLYDKLG
AHPITMDGVGGTGFVVLAPNARAVAVVGDFNCWDRRRHPMRVRGNGYWELFIPGAQTGDR
YKFAITDKSGSLLPLKSDPMAFAAEVRPNTASIVVDEAALPCPTPAAATINARRAPISIY
EVHLGSWRRGDDNRWLSYRELADTLPRYASSLGFTHIELMPVNEHPFDGSWGYQPTGLYA
PTSRFGSPDDFAHLVDACHREGLGVLLDWVPGHFPDDPHGLGHFDGTAFYEHANPLQGRH
LDWDTLIYNYGRTEVVNFLVANALFWLDRYGLDGLRVDAVASMLYLDYSRAEGGWIPNKH
GGRENLEAIAFLRRFNREVFAKFPHATTIAEESTAWPQVSRPIEFGGLGFGYKWNMGWMH
DTLDYIGKDPIYRKHHHGQILFGLHYAFSENFILPLSHDEVVHEKRSILGRMPGDDWQRF
ANLRAYYAFMFGHPGKKLMFMGAEFGQEREWNHDHALDWHLLDQARHQGVQAVVRDLNAL
YRDVPALHELDCDPAGFEWIMANDADRSVFAWMRKGESGRARCLVIANFTPTVHRSYRVR
VPFAGKWREALNTDSAHYGGSNVGNNGVVETLDGVIPELSLTLPPLAVIFLVPERA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaactgtcctccgaagcccgcgccatcgtcgaagggcggcattcagaccccttt
cactatctcggccgtcatcgcgagaatgaccgtcaggtggttcgcgcctatctgcccgag
gcatccgatgtgcgcgtcgtcgatgagcacggtggagagacgacgctgacacgcattcat
gacgccgggcttttcctcggcgacctgccgaacggcgccaagcgctaccgccttcgcgct
cgctttggcgccgacacggtcgagcttgaggacccttaccgctttccgccgatcctcagc
gatttcgatctctatctgctcggtgaaggcacggatcaacggctctatgacaagctcggc
gctcacccgataacgatggatggcgtgggcggcaccggcttcgtcgtgcttgcgcccaac
gcacgggccgtcgctgtcgtcggcgatttcaattgctgggatcgccgccgtcatccgatg
cgcgtgcgaggcaacggatattgggaattgttcattcccggcgcgcaaacgggcgaccgc
tacaaattcgcgatcacagataagagcggtagtttgttgccgctgaagtccgatccgatg
gcgttcgcggcggaagttcgaccgaacacggcgtcgatcgtagtcgatgaagcagcgctg
ccgtgccccacaccagcggccgccacgatcaatgcacgccgtgcgccgatctccatctac
gaggtccatctcggatcgtggcggcgcggcgacgacaaccgctggctgtcctatcgcgaa
ctcgcggacaccctgccgcgctatgccagcagccttggcttcacccatatcgagctgatg
ccggtgaacgagcatccgttcgacggttcgtggggctatcagcccaccggcctttacgca
ccgacgagccgctttggttcgcccgacgatttcgcgcatctggtcgatgcctgccatcgc
gaaggactcggcgtcctgctcgattgggtgcccggccactttcccgacgatcctcacgga
ctcggccatttcgacggcaccgcgttttacgaacacgccaacccgttgcagggccgccac
cttgactgggacaccctgatctacaactacggccgcaccgaagtggtcaatttcctcgtc
gccaacgcgctgttctggctcgatcgctacggcctggacggccttcgcgtcgatgctgtc
gcgtccatgctctatctcgattacagccgtgccgaaggcggctggattcccaacaaacac
ggcggccgggaaaatcttgaagccatcgcatttctgcgccgattcaacagggaggtgttc
gccaaattcccgcacgccaccacgatagcggaggaatcgacggcatggccgcaggtctcg
cgtccgattgagttcggcggcctcggattcggctacaaatggaatatgggctggatgcac
gatacgctggactatatcggcaaggatccgatctaccgcaagcatcaccacggccagatc
ctgttcgggctgcactatgcattctcggaaaatttcatcctgccgctatcgcatgacgag
gtggtgcacgagaagcgctcgatcctcggccgtatgccgggcgatgactggcagcggttc
gcaaacctgcgcgcctactacgcgttcatgttcggccatcccggcaagaagctgatgttc
atgggtgcggagttcggccaggagcgcgaatggaaccacgaccacgcacttgactggcat
cttctcgatcaggcacgacaccagggagtccaggccgtcgttcgcgatctcaacgcgctc
tatcgtgacgttccggcactgcacgaactggattgcgatccggccggattcgaatggatc
atggccaacgatgccgatcgcagcgtcttcgcctggatgcgcaaaggcgaaagcggacgg
gcgcgctgtctggtgatcgccaatttcacgccgaccgtccatcgcagctaccgcgtgcgc
gtacccttcgccggcaagtggcgcgaggcgctcaataccgactccgcgcattatggcgga
agcaatgtcgggaacaacggagtggtcgagacgctggacggtgtcatccccgagcttagt
ctgacgcttccgccgctcgcggtgatctttctggtaccggaacgcgcatga

DBGET integrated database retrieval system