KEGG   Nitrobacter hamburgensis: Nham_1550Help
Entry
Nham_1550         CDS       T00348                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
nha  Nitrobacter hamburgensis
Pathway
nha03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nha00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Nham_1550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nha03011]
    Nham_1550
Ribosome [BR:nha03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Nham_1550
  Bacteria
    Nham_1550
  Archaea
    Nham_1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABE62372
UniProt: Q1QN25
Position
1761911..1762297
Genome map
AA seq 128 aa AA seqDB search
MSKPKRERSLPENEAKAIARMLRVSPQKLNLVAQLIRGRKASAALADLQFSRKRIAGDVK
KCLESAIANAENNHDLDVDELVVAQAFVGNGMVMKRFAPRGRGRSGRIYKPFSQLTIVVR
QVEAEASA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaccaaagcgcgaacggagcctcccggaaaacgaggccaaggcgatcgcccgg
atgcttcgggtgagcccgcagaagctcaatctggttgcgcaactgatccgcggccgcaag
gcatcggcggcgctcgccgacctgcagttttcgcgcaagcggatcgcgggcgacgtgaag
aagtgcctggaatcggcgatcgccaacgccgagaacaaccacgacctcgacgtcgacgag
ctggttgtggcgcaagcgtttgtcggcaacggcatggtgatgaagcgtttcgcaccgcgc
ggccgtggccgctcgggccgtatctataaaccgttctcgcagctgacgatcgtggtgcgt
caggtcgaggccgaggcgagcgcttaa

DBGET integrated database retrieval system