KEGG   Nitrobacter hamburgensis: Nham_1736Help
Entry
Nham_1736         CDS       T00348                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00010  Glycolysis / Gluconeogenesis
nha00051  Fructose and mannose metabolism
nha00562  Inositol phosphate metabolism
nha00710  Carbon fixation in photosynthetic organisms
nha01100  Metabolic pathways
nha01110  Biosynthesis of secondary metabolites
nha01120  Microbial metabolism in diverse environments
nha01130  Biosynthesis of antibiotics
nha01200  Carbon metabolism
nha01230  Biosynthesis of amino acids
Module
nha_M00002  Glycolysis, core module involving three-carbon compounds
nha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nham_1736
   00051 Fructose and mannose metabolism
    Nham_1736
   00562 Inositol phosphate metabolism
    Nham_1736
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nham_1736
Enzymes [BR:nha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Nham_1736
Exosome [BR:nha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Nham_1736
  Exosomal proteins of bladder cancer cells
   Nham_1736
  Exosomal proteins of melanoma cells
   Nham_1736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF1254
Motif
Other DBs
NCBI-ProteinID: ABE62551
UniProt: Q1QMJ6
Position
1937414..1938166
Genome map
AA seq 250 aa AA seqDB search
MTGLRPLIAGNWKMNGLKASASELGQMIAGAGGPAQKADLLICPPATLVLAFAGAVQGSP
LRIGAQDCHPNPSGAHTGDTSAEMLADSGATAIIVGHSERRADHGETDALVRQKAEAAWR
AALIAIVCVGETQDQRDAGQTLEVVGRQLAGSLPDGATAANLVVAYEPVWAIGTGRTPTP
KDVQDVHGFIRDQLTQRFSGEGARIRILYGGSVKPSNAAELMAVPNVNGALIGGASLKAT
DFLAIAGAVA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggctgcgaccgctgattgctggaaactggaagatgaacggcctcaaggcttcg
gccagcgaactcggccagatgatcgcaggcgcgggcggccccgcacaaaaggccgatctg
ctgatctgcccgccggcgacgctggtgcttgcctttgcgggagcggttcagggatcgccg
ctgcggatcggcgcgcaggattgccatcctaatccttccggagcccatacgggcgatacg
tccgccgagatgttggccgattcgggcgccaccgccatcatcgtcggtcactccgagcgt
cgcgccgatcacggcgagaccgacgcgcttgtgcggcaaaaggcggaagcagcgtggcgg
gcggcgttgatcgccatcgtctgcgtcggtgaaacccaggaccagcgcgatgccggtcag
acgctcgaggtggtcggacggcagcttgcgggctcgctgccggatggcgcgaccgctgca
aatctcgttgtcgcctacgagccggtctgggccattggtactggacgcacgcccacacca
aaagatgtgcaggatgtccatgggtttatcagggatcagctcacacagcgctttagcggc
gagggggccaggatccgtattctctatggcggttcggtgaagccgtcgaatgccgcggaa
ttgatggcggttccgaatgtgaacggagcgctgatcggtggcgccagcctcaaggcgaca
gatttccttgcgatcgccggggctgttgcctga

DBGET integrated database retrieval system