KEGG   Nitrobacter hamburgensis: Nham_1766Help
Entry
Nham_1766         CDS       T00348                                 

Definition
(GenBank) Coenzyme A biosynthesis protein
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00770  Pantothenate and CoA biosynthesis
nha01100  Metabolic pathways
Module
nha_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:nha00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Nham_1766
Enzymes [BR:nha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     Nham_1766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: ABE62580
UniProt: Q1QMG7
Position
1969899..1970396
Genome map
AA seq 165 aa AA seqDB search
MSRVALYPGSFDPVTNGHVDVVRHAVVLCDQLIVAIGVHPGKTPLFPAGERLAMVRSVFA
PVAEKAGCAFDCTTYDDLTVAAAQKAGATILIRGLRDGTDLDYEMQIAGMNETMAPGVHT
VFVPASPGVRPITATLVRQIAAMGGDVSAFVPQSVASSLKTKFAG
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcgtcgcgctctatcccggatcgttcgaccccgtcaccaacggccacgttgat
gtcgtcaggcacgccgtcgtcctgtgcgaccagctgatcgttgccatcggcgttcatccg
ggcaagaccccgctgttcccggccggggagcgtcttgcgatggtgcggtcggtgttcgcg
ccggttgccgaaaaggccggctgtgccttcgactgcacgacctacgacgatctcacggtt
gccgccgcgcaaaaggccggcgccacgatcctgatccgcggcctgcgcgacggcaccgat
ctcgactatgaaatgcagatcgccggcatgaacgagaccatggcgcccggcgtgcatacg
gtcttcgtcccggcttcgcccggtgtccgcccgatcaccgccacactggtacggcagatc
gcagccatgggcggcgatgtgtcagcgttcgttccgcaatcggtcgcatcgagtctcaag
accaaattcgccggttga

DBGET integrated database retrieval system