KEGG   Nitrobacter hamburgensis: Nham_1787Help
Entry
Nham_1787         CDS       T00348                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nha  Nitrobacter hamburgensis
Brite
Enzymes [BR:nha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Nham_1787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD Methyltransf_23 Methyltransf_31 Methyltransf_11 Methyltransf_12 Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: ABE62601
UniProt: Q1QME6
Position
1989034..1989699
Genome map
AA seq 221 aa AA seqDB search
MSDFSTARGKMVDGQVRPSDVTDLRIIDAMLALPREVFVPEDRRALAYLDLDLDVSEKGA
PKRYLIKPMVVAKMMQAADIKSTDNVLVVGCATGYSAALAAKLADRVTATESDPALAAKA
AGILATLGLGHVTVVTAAASKGAPVNAPYDVIILEGATEVVPDLLNRQLGAEGRLVGVFA
MSRAQRAVIVTHSHSDFGHRDLFDASVPVLPGLERPAAFIF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacttttcgaccgctcgcggaaaaatggttgatggtcaggtgcgccccagcgac
gtcaccgatcttagaatcatcgacgccatgctggcgctgccgcgtgaggttttcgttccc
gaagatcgccgggcgctggcttacctggatctcgatctggacgtcagcgaaaagggcgcg
ccgaagcggtatctgatcaagcccatggtcgtcgcaaagatgatgcaggctgccgacatc
aagagcaccgacaacgtcctcgtggtgggctgcgcaaccggatactctgcggcgctggcg
gcgaaactcgcggatcgggtgacggcgaccgaaagcgacccggccctggcggcgaaagcg
gccggcattcttgcgacgctcggcctcggccatgtgaccgtcgtcaccgccgcggcgtcc
aaaggagcgcccgtcaatgcgccctatgacgttattattctggagggcgcgaccgaggtc
gttccggacctgctcaaccggcagctcggcgccgaagggcgtctggtcggcgtgttcgcc
atgagccgcgcgcaacgggcggtcatcgtcacgcattcgcattccgatttcggacacaga
gatctcttcgatgcgtcggtcccggtcttgcccgggctggagcggccggcagcttttatt
ttttaa

DBGET integrated database retrieval system