KEGG   Nitrobacter hamburgensis: Nham_2560Help
Entry
Nham_2560         CDS       T00348                                 

Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00071  Fatty acid degradation
nha00072  Synthesis and degradation of ketone bodies
nha00280  Valine, leucine and isoleucine degradation
nha00310  Lysine degradation
nha00362  Benzoate degradation
nha00380  Tryptophan metabolism
nha00620  Pyruvate metabolism
nha00630  Glyoxylate and dicarboxylate metabolism
nha00640  Propanoate metabolism
nha00650  Butanoate metabolism
nha00900  Terpenoid backbone biosynthesis
nha01100  Metabolic pathways
nha01110  Biosynthesis of secondary metabolites
nha01120  Microbial metabolism in diverse environments
nha01130  Biosynthesis of antibiotics
nha01200  Carbon metabolism
nha01212  Fatty acid metabolism
nha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nham_2560
   00630 Glyoxylate and dicarboxylate metabolism
    Nham_2560
   00640 Propanoate metabolism
    Nham_2560
   00650 Butanoate metabolism
    Nham_2560
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Nham_2560
   00072 Synthesis and degradation of ketone bodies
    Nham_2560
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Nham_2560
   00310 Lysine degradation
    Nham_2560
   00380 Tryptophan metabolism
    Nham_2560
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Nham_2560
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Nham_2560
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Nham_2560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nha04147]
    Nham_2560
Enzymes [BR:nha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Nham_2560
Exosome [BR:nha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nham_2560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABE63342
UniProt: Q1QKA5
Position
complement(2822244..2823413)
Genome map
AA seq 389 aa AA seqDB search
MTASIVGWAHTPFGKLGAETVESLVVKVATDALADAGISAGDVDEIVLGHFNAGFSAQDF
TASLVLQADPELRFKPATRVENACATGSAAVHQGVRAIASGAAKIVLVVGVEQMTHTPGL
EVGRNLLRASYLPEDGDTPGGFAGVFGKIAQAYFQKYGDQSDALAMIAAKNHKNGVANPY
AQIRRDFGYDFCRSESEKNPFVAGPLKRTDCSPVSDGAAALVLMDVETARSMRRAVNIRA
TGHAQDFLPMSKRNILDFEGCTVAWQRALAKAGVTLSDLSFVETHDCFTVAELIEYEAMG
LTPKGQGARAIKEGWTRKDGKLPINPSGGLKAKGHPIGATGVSMHVLSAMQLAGEAPEGM
QIRDARLAGIFNMGGTAVANYVSILEPVR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccagcatagtagggtgggcgcacacgccgttcgggaaattgggcgcagagacc
gtcgaaagccttgtggtgaaggtcgcaaccgacgcgctggccgatgccggcatttccgcc
ggcgacgtcgacgagatcgtgctcgggcattttaatgccggcttctcggcccaggatttt
accgcctctcttgtcttgcaagccgatccggaactccgcttcaagccggcgacgcgggtg
gagaacgcctgcgccaccggatcggcggcggtgcatcagggtgtccgcgccatcgcgtcg
ggcgcggcgaagatcgtgctggtcgtcggcgtcgagcagatgacgcacacacccggtctc
gaggtcggccgcaatctgctgcgcgcctcttatctgcccgaggacggcgataccccgggc
ggttttgccggcgttttcggcaagatcgcgcaggcctatttccagaaatatggcgaccag
tcggatgccctggcgatgatcgcggcgaaaaaccacaagaatggggtcgccaacccttac
gcgcagatacgcagggatttcggctacgacttctgccgctccgagagcgagaagaacccg
ttcgttgcggggccgctgaagcgcaccgactgctcgccggtgtcggacggcgcggccgcg
ctggtgctgatggatgtggagacggcccgatccatgcgcagggcggtcaacatccgcgcg
accggccacgcgcaggatttcctgccgatgtcgaagcgcaacatcctcgatttcgagggc
tgcacggtggcgtggcagcgggcgctggcgaaggccggtgtgacgctgtccgatctctcg
ttcgtcgagacccacgactgcttcaccgtcgccgaactgatcgagtacgaagccatgggc
ctgacgccgaaggggcagggcgcgcgcgccatcaaggaaggctggacccggaaggacggc
aagctgccgatcaatccgtccggcggcctcaaggccaagggccatccgatcggcgccacc
ggagtctccatgcacgtgctgagcgcgatgcagctcgctggcgaggcgcccgagggtatg
cagatcagggacgccaggctcgccggcatcttcaacatgggcggtacagcggttgcgaac
tacgtctcgatccttgagccggtgcgatag

DBGET integrated database retrieval system