KEGG   Nitrobacter hamburgensis: Nham_3211Help
Entry
Nham_3211         CDS       T00348                                 

Definition
(GenBank) glycyl-tRNA synthetase alpha chain
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:nha00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Nham_3211
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nha01007]
    Nham_3211
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nha03016]
    Nham_3211
Enzymes [BR:nha01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Nham_3211
Amino acid related enzymes [BR:nha01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Nham_3211
Transfer RNA biogenesis [BR:nha03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Nham_3211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e N-glycanase_C
Motif
Other DBs
NCBI-ProteinID: ABE63946
UniProt: Q1QIK1
Position
complement(3537650..3538594)
Genome map
AA seq 314 aa AA seqDB search
MDSLPPHMRPERSFQGLILTLQRYWADFGCVILQPYDMEVGAGTFHPATTLRALGPKRWN
AAYVQPSRRPKDGRYGENPNRLQHYYQFQVILKPSPPDIQDLYLKSLAAIGVDSALHDIR
FVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGVECAPVAGELTYGLERLAMFVQ
GVDRVYDLNFNGREGADKVTYGDVFLQAEQEYSRHNFEHSDTAMLFEQFRMAESACKTYL
EAGWQDNPQKPGKREAHLMVLPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAK
ACGEAWLHTEAGGV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggactccttgcccccgcacatgcgcccggaacgctcgttccagggcctgatcctgacc
ctgcaacgctactgggcagacttcggctgcgtgatcctgcagccctatgacatggaggtg
ggggcgggcacctttcatcccgcgaccacgcttcgcgcgctgggtccgaagcgctggaac
gcggcctatgtgcagccgtcgcgccggcccaaggacggccgctacggcgagaaccccaac
cgcctgcagcactactatcagttccaggtgatcctcaaaccgtcgccgccggacatccag
gacctctatctgaaatcgctggccgccatcggcgttgacagcgcgctgcatgacatccgc
ttcgtcgaggacgactgggaaagcccgacgctgggggcgtgggggctcggctgggagtgt
tggtgcgacggcatggaggtcagccagttcacctacttccagcaggtggcgggcgtcgaa
tgcgcgccggtggcgggcgaacttacctacgggctggagcggctcgcgatgttcgtgcag
ggcgtcgaccgcgtctacgatctcaacttcaatggccgcgagggtgccgacaaggtgacc
tatggcgacgtcttcctgcaagccgagcaggaatattcgcggcacaacttcgagcattcc
gacaccgcgatgctgttcgagcaattcaggatggccgagagcgcgtgcaagacatatctc
gaagcggggtggcaggacaatccgcaaaagcccggcaaacgcgaggctcatctgatggtg
ctgccggcctacgaccagtgcatcaaggcgagccatgtcttcaacctgctcgacgcgcgc
ggcgtgatctcggtgaccgagcgccagagctacatcctgcgggtgcgcgaactggcgaaa
gcctgcggcgaggcgtggctccataccgaagcgggcggcgtctag

DBGET integrated database retrieval system