KEGG   Nitrobacter hamburgensis: Nham_3267Help
Entry
Nham_3267         CDS       T00348                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00480  Glutathione metabolism
nha00590  Arachidonic acid metabolism
nha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Nham_3267
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Nham_3267
Enzymes [BR:nha01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Nham_3267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ABE64001
UniProt: Q1QIE6
Position
complement(3598554..3599030)
Genome map
AA seq 158 aa AA seqDB search
MSGVFDFSANTLAGEPCALKLFEGQVLLIVNTASACGFTPQYKDLEELYRAMKPRGFSVL
GFPCNQFGKQEPGSPADIQQFCESKYDVTFPMFAKIEVNGDNAHPLYKYLKREKSGLLGA
SIKWNFTKFLVDRQGNVVARHAPTTKPKTLTQEIEALL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtgtctttgatttctccgcgaacacgctggccggcgagccctgcgcattgaag
ctgttcgagggacaggtccttctgatcgtgaataccgcgagcgcctgcgggttcacaccg
caatacaaggacctcgaggagctctatcgcgccatgaagccgcgcgggttttccgtgctc
ggcttcccctgcaatcagtttggcaagcaggagccgggatcaccggcggatatccagcag
ttctgtgagagcaaatacgatgtaacgtttccgatgtttgcgaagatcgaggtcaacggc
gataatgctcacccgctttacaaatacctgaagcgcgagaagtccggattgctcggcgct
tcgatcaagtggaatttcacgaagtttctggttgatcggcagggcaacgtcgttgcccgt
cacgctccgaccaccaaacccaaaacgctcacgcaagagatcgaggccctgctttga

DBGET integrated database retrieval system