KEGG   Nitrobacter hamburgensis: Nham_3534Help
Entry
Nham_3534         CDS       T00348                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00010  Glycolysis / Gluconeogenesis
nha00030  Pentose phosphate pathway
nha00051  Fructose and mannose metabolism
nha00680  Methane metabolism
nha00710  Carbon fixation in photosynthetic organisms
nha01100  Metabolic pathways
nha01110  Biosynthesis of secondary metabolites
nha01120  Microbial metabolism in diverse environments
nha01130  Biosynthesis of antibiotics
nha01200  Carbon metabolism
nha01230  Biosynthesis of amino acids
Module
nha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
nha_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nha_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nham_3534
   00030 Pentose phosphate pathway
    Nham_3534
   00051 Fructose and mannose metabolism
    Nham_3534
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nham_3534
   00680 Methane metabolism
    Nham_3534
Enzymes [BR:nha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Nham_3534
Membrane trafficking [BR:nha04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Nham_3534
Chromosome and associated proteins [BR:nha03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    Nham_3534
Exosome [BR:nha04147]
 Exosomal proteins
  Proteins found in most exosomes
   Nham_3534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycolytic S-AdoMet_synt_N
Motif
Other DBs
NCBI-ProteinID: ABE64263
UniProt: Q1QHN4
Position
3886676..3887707
Genome map
AA seq 343 aa AA seqDB search
MNLADLNTVAQAMVVPGKGILAADESSGTIAKRFDVIGVTSTEESRRDYREMLFRASDAM
TKYISGVILYDETIWQNARDGTPLVKLIEQAGAIPGIKVDEGTQPLPGCPGELVTVGLDK
LAERLKKYYAQGARFAKWRAVIDINAAGGIPSMTAIGVNAHALGRYAALCQAAQIVPIVE
PEVLMDGDHDIERCFDVTSRVLNVTFQELRKQRVALEGMILKPNMAIAGKKSTKKASVEE
VAEKTVRMLKACVPAAVPGIAFLSGGQSDEEATAHLDAMNRIGNLPWKLTFSYGRALQSA
PQKAWSGKAENVVAGQRALTHRAQMNSLATKGEWKADLEKKAA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgctgacctcaacacagtggcgcaagccatggtcgtgcccggcaagggcatt
ctcgccgccgacgaatcctccggaaccatcgcaaaacggtttgacgtgatcggtgtgacc
tccaccgaggaaagccgccgcgactaccgcgagatgctatttcgcgccagcgacgccatg
acgaaatacatctccggcgtcattctctacgacgagaccatctggcagaacgccagggac
ggcaccccgctggtcaagctgatcgagcaagcgggcgccattcccggcatcaaggtcgac
gagggcacacaaccgctgcccggatgccccggcgaactcgtgaccgtcggactggacaag
ctcgccgagcgcctgaagaaatactacgctcagggcgcacgcttcgcgaaatggcgcgcg
gtgatcgacatcaacgcggccggcggcatcccgagcatgacggcgatcggcgtcaacgcc
catgcgctggggcgctatgctgcgctgtgccaggccgcccagatcgtgccgatcgtcgag
ccggaagtgctgatggacggcgatcacgacatcgagcgctgctttgatgtcacgtcgcgc
gtgctcaacgtgacgttccaggagttgcggaagcaacgcgtcgcgctggaaggcatgatc
ctgaaaccgaacatggcgatcgcgggcaagaagagcacgaagaaggcctcggtggaggaa
gtggcggaaaagaccgtgcgtatgctgaaagcctgcgtgccggccgccgtccccggcatc
gccttcctgtccggcggacagtccgacgaagaggccaccgcccatctcgacgccatgaac
cggatcggcaacctgccgtggaagctcactttctcctatggccgcgcgctgcagtcggcg
ccgcagaaagcgtggtccggcaaggccgaaaacgtcgtcgccgggcaacgggctctcacc
caccgcgcgcagatgaattcgctcgccaccaagggtgagtggaaagccgatcttgaaaag
aaggctgcgtga

DBGET integrated database retrieval system