KEGG   Nitrobacter hamburgensis: Nham_3751Help
Entry
Nham_3751         CDS       T00348                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00630  Glyoxylate and dicarboxylate metabolism
nha00710  Carbon fixation in photosynthetic organisms
nha01100  Metabolic pathways
nha01110  Biosynthesis of secondary metabolites
nha01120  Microbial metabolism in diverse environments
nha01130  Biosynthesis of antibiotics
nha01200  Carbon metabolism
Module
nha_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nha_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nham_3751
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nham_3751
Enzymes [BR:nha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Nham_3751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABE64475
UniProt: Q1QH22
Position
complement(4131118..4132584)
Genome map
AA seq 488 aa AA seqDB search
MNVLNEKSLTVRGKDRYKSGVMSYKKMGYWEPDYTPKDTDIICLFRVTPQDGVDPIEAAA
AVAGESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPGAEGQYFAYIAYDLDLFESGSISN
LTASVIGNVFGFKPLKALRLEDMRLPVAYVKTFKGPPTGIVVERERLDKFGRPLLGATVK
PKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYCMEAVNRAQAATGEV
KGSYLNVTAATMEDMYERAEFAKELGSVVVMIDLVIGYTAIQSMSNWARKNDMILHLHRA
GHSTYTRQRNHGVSFRVISKWMRLAGVDHIHAGTVVGKLEGDPLTTRGYYDICREEHNPM
QLEHGIFFDQNWASLNKMMPVASGGIHAGQMHQLIQHLGEDVVLQFGGGTIGHPMGIQAG
AIANRVALEAMILARNEGRDYVSEGPDILAKAAASCTPLKQALEVWKDVTFNYQSTDAPD
YVTTPAVA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtccttaacgagaagtcgctgacggttcgcggcaaggaccgttataaatccggt
gtcatgtcctacaagaagatgggctattgggagcccgactatacgccgaaggacacggac
atcatttgtctgtttcgggttacgccgcaggacggcgtcgacccgatcgaagcggctgcg
gcggtggccggcgaatcctcgaccgcgacctggaccgtggtgtggacggatcgtctgacg
gcggcggaaaagtatcgcgccaagtgctaccgcgtcgatccggtcccgggggcggaaggc
cagtacttcgcctatatcgcctacgatctcgacctgttcgaatccggctcgatctccaac
ctcaccgcgtcggtcatcggtaacgtgttcggcttcaagccgcttaaggccctgcgcctc
gaggacatgaggctgccggtcgcctacgtcaagacgttcaaaggaccgcccaccggcatc
gtcgtcgagcgcgagcgtctcgacaagttcggccggccgctgctcggcgccaccgtcaag
ccgaagctcggcctgtccggccgcaattacggccgcgtggtctatgaggcgctgaagggc
ggtctcgacttcaccaaggacgacgagaacatcaactcgcagccgttcatgcactggcgt
gaacgtttcctctactgcatggaagcggtcaaccgcgcccaggcagcgaccggcgaagtc
aagggcagctacctcaacgtcaccgcggcgacgatggaggacatgtacgagcgtgccgag
ttcgccaaggagctagggtcggtggtcgtcatgatcgatctggtgatcggctacaccgcg
atccagtcgatgtcgaactgggcgcgcaaaaacgacatgatcctgcatctgcatcgcgcc
ggtcattcgacctacacgcggcagcgcaatcacggcgtgtcgttccgcgtcatctccaaa
tggatgcggctcgccggtgtcgatcacatccacgccggaaccgtggtcggcaagctggaa
ggcgatccgctgaccacgcgcggctactacgatatctgccgcgaagagcacaatccgatg
cagctcgagcatggcatcttcttcgaccagaactgggcgagcctcaacaagatgatgccg
gttgcttccggcggcattcatgccggccagatgcaccagctcatccagcatctcggtgag
gacgtagtgttgcagttcggcggcggcaccatcggtcacccgatgggcatccaggccggc
gcgatcgccaatcgcgtggcgctggaggcgatgatcctcgcccgcaacgagggccgcgat
tacgtcagcgaaggtccggatatcctggccaaggcagccgcaagctgcacgccgttgaag
caggcgctcgaagtgtggaaggacgtcaccttcaactaccaatccaccgacgcgcccgat
tatgtaacgaccccggccgtagcgtaa

DBGET integrated database retrieval system