KEGG   Nitrobacter hamburgensis: Nham_4371Help
Entry
Nham_4371         CDS       T00348                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00010  Glycolysis / Gluconeogenesis
nha00052  Galactose metabolism
nha00500  Starch and sucrose metabolism
nha00520  Amino sugar and nucleotide sugar metabolism
nha00521  Streptomycin biosynthesis
nha01100  Metabolic pathways
nha01110  Biosynthesis of secondary metabolites
nha01120  Microbial metabolism in diverse environments
nha01130  Biosynthesis of antibiotics
nha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nham_4371
   00052 Galactose metabolism
    Nham_4371
   00500 Starch and sucrose metabolism
    Nham_4371
   00520 Amino sugar and nucleotide sugar metabolism
    Nham_4371
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nham_4371
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Nham_4371
Enzymes [BR:nha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Nham_4371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase DUF3261
Motif
Other DBs
NCBI-ProteinID: ABE64962
UniProt: Q1QFN5
Position
p2:complement(22288..23238)
Genome map
AA seq 316 aa AA seqDB search
MTALRVIGDIGGTYARFAVAERGKYSELQHLSVSKYAALKDALGEYLAALPRDLRPTRGA
LAVAGPVSGDEVKLTNLNWSFSITALKADLGMSSLVVVNDFAATAMSVPYLPEADCYPIG
PPQSKTSGPVGVIGPGTGLGVSALVPDAGRWILLPGEGGHSTLPPATQAESLIVEVLRTH
WPHVSAERALSGAGLVNLYQALCSIEGKRPDPLSPADVTDRAMRGSDPTCVKAFEVFCSM
LGTVAGDLALTIGATGGIYIAGGILLRFKEAFASSPFRDRFEDKGRFQDYLRRIPTLLIL
EESPALLGLANLPLEP
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccttgcgggtaatcggcgacatcggcgggacctacgcccgattcgctgtcgca
gaacgcggaaagtacagtgagcttcagcatctgagcgtgagcaaatacgctgccttgaag
gacgcactcggcgagtatttggctgcgctgcctcgcgacctgcgacccaccagaggagcg
cttgcagttgccggtcctgtgtccggagatgaggtgaaactgaccaacctcaactggtct
ttctcaataaccgcactcaaggccgacttgggtatgagctcactcgtcgttgtcaacgat
ttcgccgctaccgcaatgtcggttccttatctcccggaagccgactgctatccgatagga
ccgcctcaatcgaagacgagcggcccggtcggcgtcatcggacccggtactggtctcggg
gttagcgcgctggttccggacgccggcagatggatcttgctacctggcgaaggcggacat
tcgacgttgccgccggctacgcaagcggaaagtctcatcgttgaagtacttcgaacccat
tggccgcatgtctcggcggagcgcgcactctcgggcgcgggcctggtgaatctctatcag
gcactctgttcaatagaaggcaaacgtcctgatccgttatcgccggcagatgtgaccgat
cgggcaatgcggggaagcgatccgacctgcgtgaaagcattcgaggttttctgttcaatg
ctggggacagtggccggcgatctagcgctcaccataggcgcaacgggtggcatctacatc
gcaggtgggattctgctccgcttcaaggaggcatttgcctcctctccgtttcgggaccgt
ttcgaagacaagggtcggttccaagactatcttcgcagaattccgactctccttattcta
gaggaatcgcccgcgcttctaggtcttgccaatcttccacttgagccgtga

DBGET integrated database retrieval system