KEGG   Nitrobacter hamburgensis: Nham_4559
Entry
Nham_4559         CDS       T00348                                 

Definition
(GenBank) conjugation TrbI-like protein
  KO
K20533  type IV secretion system protein TrbI
Organism
nha  Nitrobacter hamburgensis
Pathway
nha02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nha00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Nham_4559
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nha02044]
    Nham_4559
Secretion system [BR:nha02044]
 Type IV secretion system
  Trb secretion system protein
   Nham_4559
SSDB
Motif
Pfam: TrbI YibE_F FmiP_Thoc5
Other DBs
NCBI-ProteinID: ABE65134
UniProt: Q1QF63
Position
p3:complement(15988..17289)
AA seq 433 aa
MAQSLKLGGTPEGEEARGIRRLNQLPIIVAIVLVIVFFAVIFYGLTSRGLYVHRAAGIDT
ASSSPATTFADQLKKGISNGIIGDQSEAQAFQPAPQSEAPKPPSNPLAGRQQAEASASTL
EREAVWRARLEREAHEQYLRERQRERMARVQANDAAYDSPLALNLGKLQTSTAPTSGGAP
SKATSTPGFAGGANDLYAAALRAGFGTQNIDPNGQGAKEDFFNADLKKLGYLPNKVVAPT
SAYELKRGSVIPATLITGINSDLPGRITAQVSQNVYDSATGHDLLIPQGTKLLGRYDSKI
SFGQSRVLVIWTDIIFPNGATLQIGGMAGTDSEGYGGFNDQVDNHYFKVFGSAILIAAIG
AGIDMSVPASSPYGYRQTPTDAARNSFAETFGRVAEQTISKNLNVQPTLEIRPGYVFNVL
VDQDMVFLGAYRG
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggcgcaatccctgaagctcggcggcacaccggagggcgaggaggcgagaggcatccga
cgcctcaaccagctgccgatcatcgtcgccatcgtgctggtgatcgtgttcttcgccgtg
atcttctacggcctcacctcgcgcgggctttatgtccatcgagcggccgggatcgacacg
gcttcgtccagtccagccaccaccttcgccgatcagctgaagaagggaatctccaacggc
attatcggcgaccagtcggaggcgcaagcctttcagccggcgccgcagtccgaagcgccg
aaacccccgagcaatccgctcgccggccgacaacaagccgaagcgtcggcatcaacgctc
gagcgggaggcagtctggcgggcgcgcctcgagcgggaggcgcatgagcaatatctgcgc
gaacggcagcgcgagcgcatggcgcgcgtccaggccaacgatgccgcctatgattctcca
cttgccctcaatctcggcaagcttcagacgtcgaccgcgccgacgagcggcggagcaccg
tcgaaggcaacgtcgacaccgggctttgccggcggcgcgaacgatctctacgcggcggcg
ctgcgcgcgggtttcggcacgcagaacatcgatccgaacgggcagggggcgaaggaggac
ttcttcaacgccgacctgaagaagctcggctaccttcccaacaaggtggtcgcgccgacc
tcggcctatgaactcaaacgcggctcggtcattccggcgacgttgatcaccggcatcaac
tccgatcttcccggtcgcatcaccgcccaggtcagccagaacgtctacgacagcgccacg
gggcatgacctgttgatcccgcaaggcacgaaattgttggggcgctacgattccaagata
tcgttcggccaaagccgtgtgctggtcatctggacggacatcatcttcccgaacggcgcg
acgttgcagatcggcggcatggcgggcacggattctgaaggctatggcggtttcaacgat
caggtcgacaaccactatttcaaggtgttcggctcagcgatcctgatcgctgcgatcggc
gcgggcatcgatatgtcggtgccggcgagctctccctatggctatcggcaaacgccaacg
gacgcggcgcgaaacagctttgccgagaccttcggccgcgtcgccgaacagaccatcagc
aagaatctcaacgtccagccgacgctggagattcggccgggctacgtattcaacgtgctc
gtcgaccaggacatggtgtttctaggcgcttaccgtggatga

DBGET integrated database retrieval system