KEGG   Fusarium vanettenii: NECHADRAFT_100268
Entry
NECHADRAFT_100268 CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
nhe  Fusarium vanettenii
Pathway
nhe00100  Steroid biosynthesis
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
Module
nhe_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    NECHADRAFT_100268
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     NECHADRAFT_100268
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 9672482
NCBI-ProteinID: XP_003045442
JGI: 100268
UniProt: C7Z7Q4
Position
4
AA seq 485 aa
MALKSSKAVSEEQHGYEFFGPPGAFAISFLLPVLVYVFNFVCNDISGCPAPSLLSPKTLS
LDQLKQEVGWPQDGFAGLVSWEASAATAGYILLSLILYRVLPAHEVEGTELRSGGRLKYR
LNTLYSSSFTLAILAAGTAAQGAEFPVWTFISDNFIQILTANTIFSYAVATFVYVRSFSV
KPGNKENRELAAGGHTGNMLYDWFIGRELNPRVVIPLIGEVDLKEWLELRPGMMGWIIFN
CSWCAQQYRNYGYVTDSSICITLVQAVYVFDSWWNEPAILTTMDITTDGFGMMLAFGDIV
WVPFVYSLQTRYLAVHPVSLGPVGLAVMLSLIGLGFYIFRSANSEKNNFRTNPNDPKVSQ
LKYIQTKKGSKLLISGWWGIARHINYLGDWIQSWPYCLPTGLAGYQILNAGAQAEGALVM
RDGREVVQGEAKGWGMLITYFYILYFAILLIHRERRDDDKCHRKYGEDWEKYRKIVRYRI
IPGIY
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggctctcaagtctagcaaggctgtctctgaggagcagcatggctacgagttctttgga
cctcccggtgcattcgccatctccttcctccttcccgtcctcgtatacgtcttcaacttt
gtctgcaacgacatctcgggttgccccgcgccgtctctgctgagccccaagaccctttcg
ctcgaccagctcaaacaggaggttggatggccacaagatggcttcgctggacttgttagc
tgggaggcttctgctgctacggctggctacatcctgctgtctctgatcctttaccgcgtg
cttcccgctcatgaggtggagggcactgagctgcgctctgggggtcgtctcaagtataga
ctcaacactctgtacagcagttcgttcaccctggctattctcgccgccggaaccgcagcc
cagggcgccgagttccccgtctggaccttcatctcggacaacttcatccagatcttgacc
gccaacaccatcttctcgtacgccgtggccacctttgtctacgtccggagcttcagcgtc
aagccgggaaacaaggagaaccgcgagctcgccgcgggagggcacacgggcaacatgctg
tacgactggttcattggccgcgagctgaacccccgggttgtcatccccctgattggcgag
gttgacctcaaggagtggctggagctccgacctggcatgatgggttggatcatcttcaat
tgctcctggtgtgcgcagcagtaccgcaactacggctacgttaccgacagctccatctgc
atcacacttgtccaggccgtctacgtctttgactcttggtggaacgagccagccattctg
accaccatggacatcacgactgacggtttcggaatgatgcttgcctttggtgacattgtc
tgggtgccctttgtctactccctgcagacccggtacctggctgtgcaccctgtctcactc
ggccctgttggtcttgctgtgatgctgtccctcattggtcttggcttctacatcttccgc
tctgccaacagcgagaagaacaacttccgaaccaaccccaacgaccccaaggtgtcccag
ctcaagtacatccagaccaagaagggtagcaagcttctcatctctggctggtggggaatt
gctcgacacatcaactacctgggcgactggatccagtcttggccctactgcctacccact
ggtcttgccggctaccagatcctgaacgccggtgcccaggccgagggagcgttggtgatg
cgggatggccgagaggttgtccagggtgaggccaagggatggggcatgctcatcacctac
ttttacatcctgtactttgccatcctcctcatccaccgcgagcgccgtgacgacgacaag
tgtcaccgcaagtacggcgaggactgggaaaagtaccgcaagattgtccgctaccggatc
atccccggaatctactga

DBGET integrated database retrieval system