KEGG   Nectria haematococca: NECHADRAFT_105230Help
Entry
NECHADRAFT_105230 CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01519  inosine triphosphate pyrophosphatase [EC:3.6.1.-]
Organism
nhe  Nectria haematococca
Pathway
nhe00230  Purine metabolism
nhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NECHADRAFT_105230
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     NECHADRAFT_105230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-GeneID: 9665724
NCBI-ProteinID: XP_003050317
JGI: 105230
UniProt: C7YTE3
Position
9
AA seq 184 aa AA seqDB search
MAAHKVNFITGNANKLREVKAILEPEIEVTSKSIDLEEVQGTLEEVTESKCRRAAELVKG
PVLVEDTALCYTALGGLPGAYIKWFLTTIGHQGLNNLLAAYTDKSAEAVCTFGYCAGPGE
KVILFQGRCPGKIVPARGPNNFGWDPVFEYEGQTFAEMDKVEKNKISHRSRALAKLQAWF
KEQQ
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcacaaggtcaacttcatcactggcaatgccaacaagctgcgcgaggtcaag
gctatcctcgagccagagattgaggtgacgagcaagtctattgatcttgaggaggtgcag
ggtacgcttgaggaggttacagagtccaagtgccgcagggctgctgagttggtgaagggc
cctgtgctggtcgaggataccgcgctgtgctacacggcgctgggtggtcttcctggagcg
tacatcaagtggttcttgactaccatcggtcaccagggtttgaacaacctcctggctgct
tataccgacaagtctgccgaggctgtctgcacatttggctactgtgctggaccaggcgag
aaggtcattctcttccaaggccgctgccccggcaagattgttcctgctcgaggacccaat
aactttggatgggatcctgtctttgagtatgaaggccaaacgttcgccgaaatggacaag
gttgaaaagaacaagatctcccaccgaagccgcgcgctggccaagctgcaggcttggttc
aaggagcagcagtaa

DBGET integrated database retrieval system