KEGG   Nectria haematococca: NECHADRAFT_36849Help
Entry
NECHADRAFT_36849  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     NECHADRAFT_36849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 9663961
NCBI-ProteinID: XP_003052609
JGI: 36849
UniProt: C7YM79
Position
3
AA seq 706 aa AA seqDB search
MSTVFPANALSQLGPPQTVADIAALTAVGVASAAYLLRGIAWDRPDPYDYIWYERMGSKD
GAASRPKATRDIAKKMEESGKDVVIFWGSQSGTAEMFANRLSKECHLRFGLQTLCADLCD
YDPDSIANLPQSKLAIFIISTYGEGDPSDNTAALWDWLNKRPFDIKLPNLRYMAFGLGNS
SYRYYNRVIDVVAEALDKAGAQRLMPVGKANDAQGGTEEDFLSWKDDLYTHFQEKLGYEE
RDIPYEPSIKIVEDESLDIMDLNLGEPVQNRSGPAKIVKQYSPIRPLTVQESRELYTSPG
RNCIHMELDLSDQAELRYRTGDHLAVYPINPDHEVQLLLKALGLEQRAETPLLIRALEEG
ESIKIPSPTSLLAVFRHYLEVSAPVSRETVGALARFAPSPEVANVLATLGKDKKAYAEFI
GKNHITLGRLLALAAPGAVWTNLPLTYVVETLPTIQPRYYSISSSSAVSARKVAITVGVD
NSPLQADATKAIRGVTTNYLYALGNSLNGDAAQPEVGPDAPTYALSGPGDTLKGHKVFAC
IRRSNFKLPTLGTTPLVMIGAGTGMAPFRGFILERARLKAVGKPIGRMILFFGCRSPDQD
YLYREELASVAKELDGLLEIVPAFSRSNSHSKSYVQDKVGEMKKDVCELLQGGANMYICG
RASMAREVGNVVEESMKQQNSWTDAEARSWAESAKKGSKWLEDVWG
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgtctttcctgcaaatgccctgtcccaactggggccaccccagactgtcgcc
gacattgctgcactgactgcagtcggcgtggcatcggccgcctatctcctccgtggcatc
gcatgggacagaccagacccgtacgattacatctggtacgaacgcatggggtccaaggat
ggtgcagcatcaagacccaaggcgacccgtgatattgccaagaagatggaagagagtggc
aaggatgtcgtcatcttctggggttcacagtccggcacagcagaaatgtttgccaacaga
ctctccaaggagtgtcaccttcgcttcggcctccagaccctctgcgccgacctttgcgac
tacgatccagactccattgccaacctcccccagagcaagctcgccatcttcattatctcc
acctatggcgagggagaccccagcgacaacaccgccgctctctgggactggctcaacaag
cgaccttttgatatcaagcttcccaacctccgttacatggcatttggtctgggaaacagc
agctaccgctactacaaccgtgtcatcgatgtcgtggctgaggcccttgacaaggccggc
gctcagcgtttaatgcccgtgggcaaggccaacgacgcccaaggcggcaccgaagaagat
ttcctctcgtggaaggatgatctctacacgcacttccaggagaagctcggctacgaggag
cgagacatcccctacgagcccagcatcaagatcgtcgaggacgagtccctcgacatcatg
gacctcaaccttggcgagcccgtccagaaccgcagcggccctgccaagatcgtcaagcag
tactcgcccattagacccctaacagtgcaggagtcgcgtgagctctacacgtcccccggc
aggaactgtatccacatggagctggacctcagtgaccaggctgagctccgctaccgaact
ggagaccacctcgctgtgtatcccatcaaccctgatcacgaggtgcagctccttctcaag
gcactgggacttgagcagcgagccgagacgcctcttctcatccgagccctggaggagggc
gagtccatcaagatccccagtcctacctcgttgctagctgtcttccgtcactacctcgaa
gtgtctgcccctgtctctcgtgagactgtcggtgccctcgctcgcttcgccccttcgcca
gaggttgccaacgttctggcaacccttggaaaggacaagaaagcctatgccgagttcatt
ggcaagaaccacatcactctaggccgtctcctggcactggctgctcctggtgctgtctgg
accaacctccccctgacctacgtcgtggagactcttcctacaatccagccccgatactac
tccatctcttcatccagcgccgtctccgcccgcaaggtcgccatcaccgtcggcgtcgac
aactcccccctccaagccgacgcaaccaaggccatccgtggcgttaccacaaactacctt
tatgccctcggaaactctctcaacggcgacgctgcccagccagaagttggccccgacgcc
cccacctacgctctctcgggccctggcgataccctcaagggccacaaggtctttgcttgc
attcgtcgctcaaacttcaagctccctacccttgggacaacccccctcgtcatgattggt
gccggcaccggcatggctcccttccgtggcttcatcctcgagcgtgctcgtctcaaggcc
gttggaaagcccattggtcgcatgatcctcttctttggctgccgctccccggaccaggac
tacctctatcgcgaggagctcgcctcagtagccaaggagctggacggcctccttgaaatc
gtccccgctttctcgaggtctaacagccactccaagtcctacgtacaggacaaggtcggc
gagatgaagaaggatgtatgtgagctgctccagggcggcgccaacatgtacatctgcggc
agggcgtcgatggctcgcgaggtgggcaacgtggttgaggagtcgatgaagcagcagaac
agctggaccgacgccgaggcccggagctgggctgagtctgccaagaagggcagcaagtgg
ctcgaggatgtctggggttaa

DBGET integrated database retrieval system