KEGG   Nectria haematococca: NECHADRAFT_37766Help
Entry
NECHADRAFT_37766  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nhe  Nectria haematococca
Pathway
nhe00860  Porphyrin and chlorophyll metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NECHADRAFT_37766
Enzymes [BR:nhe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NECHADRAFT_37766
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEM4 DUF5047
Motif
Other DBs
NCBI-GeneID: 9672846
NCBI-ProteinID: XP_003051495
JGI: 37766
UniProt: C7YP43
Position
4
AA seq 313 aa AA seqDB search
MTSSSKVPVLLLKTRSSPGDSYEDLFSETSAAGASFAPQFVPVLLHQFQDEGMKKVAEVL
REGRIGNKEHHEYGGLIFTSQRAVEAFVKLVQDGKDENDSIKNDPPTSWPHLQHIPVYSV
GPATTRALAAVPQDPPLSVFGSHTGNGATLAPYILSHYREWHAGRPSLPPVLFLVGETRR
DIIPKTLQDPGLPDGERIAVDETVVYGTGVMESFPIDLDRVLSETQDAPARWVVVFSPTG
CDSLLQVMGVLDPETGKVREGSVRDGKTYVATIGPTTRDHLKSFGFEPDVCAESPTPQGV
LDGIQEFMTRNQS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacatcttccagcaaggtgccggtcctcctgctcaagacgaggtcgagtcccggtgat
tcatacgaggaccttttctccgagacgagcgccgctggagcttcctttgcgccgcagttt
gttcccgtgctgttgcaccaattccaagatgagggcatgaaaaaggttgcagaggtgctc
cgcgagggacggattggaaacaaggagcatcatgagtatggcggcttgatctttacttca
cagcgcgcggttgaggcgtttgtgaagttggtgcaggacggcaaggatgagaatgacagc
atcaaaaatgaccccccgacgtcgtggcctcacctccagcacattcccgtctacagcgtc
ggccccgcgacgacccgcgccctcgccgccgtcccgcaggatcctcccctgagcgtcttc
ggtagccacacgggcaacggcgcgaccctcgccccttatatcctctctcactaccgcgaa
tggcacgccggccggccgtcgttgcctcccgtgctgtttctcgttggcgagactcgacgg
gacattattcccaagacgttgcaggaccctgggctgccggacggcgagcgcatcgcagtt
gacgagacggtcgtttacggaacgggcgtcatggagagcttccccatcgacctggatcgc
gtgctttctgagacacaggatgcgcctgcacgttgggtggtagtattctcgccgacgggg
tgcgatagcctactccaagttatgggcgtgctggacccggagacgggcaaggtgcgtgag
gggagcgtgcgggatggcaagacgtatgtcgcgacgattgggcctacaacaagagatcac
ctcaagtcgtttggctttgagcccgacgtgtgtgccgagtcaccgacgccgcagggcgta
ttagacgggatccaagagtttatgactaggaatcaaagttga

DBGET integrated database retrieval system