KEGG   Nectria haematococca: NECHADRAFT_38340Help
Entry
NECHADRAFT_38340  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
nhe  Nectria haematococca
Pathway
nhe00010  Glycolysis / Gluconeogenesis
nhe00052  Galactose metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
nhe01130  Biosynthesis of antibiotics
Module
nhe_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NECHADRAFT_38340
   00052 Galactose metabolism
    NECHADRAFT_38340
Enzymes [BR:nhe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     NECHADRAFT_38340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 9668787
NCBI-ProteinID: XP_003052076
JGI: 38340
UniProt: C7YPW4
Position
4
AA seq 340 aa AA seqDB search
MADAPISFIPLGAIVQSLVVKGINIVQGFANQEEYEKYNSPYFGVTVGRVANRIKGARLD
SLNGKEYTLAANNGPNHLHGGEVGWSKRVWDGPKPVGVREVPGIENLEGGESVAFTLTSE
DGDEGYPGTVEVTVVYTTGIQKAEGKEVTILAMDYEAKLIDGADETVINMTNHSYFNLSG
QETIDGTNITLPTNKYLAVDEGLIPTGKIEPFPGVNANEAVLMGVKEPNIDHCFVLNTDP
SSVPLDTRSEPLNLNLKAHHAGAGVNLEVLSTEPTFQVYTGSGIDVPEVNGKAARISRSG
FCCEPARYVNAANVPEWKNMVLLKKGDTYGARIVYKAWAD
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgctcccatctccttcattcccctcggcgccatcgtccagtccctggtcgtc
aagggcatcaacattgttcagggtttcgccaaccaggaggaatatgaaaagtacaactcg
ccttacttcggcgtcactgtaggccgtgtcgcaaaccgcatcaagggtgcccgcctcgat
agcctcaatggcaaggagtacaccctcgctgcaaacaatggccctaaccacctccacggt
ggtgaggtcggctggagcaagcgcgtctgggacggtcccaagcctgttggcgtccgtgag
gtccctggtattgagaaccttgagggtggcgagagcgttgcctttaccctcaccagcgag
gacggcgatgagggttaccccggtaccgtggaagtgactgtcgtctacacgactggcatc
caaaaggctgaaggaaaggaggtcaccattcttgccatggactacgaggccaagctcatc
gacggcgctgatgagaccgtcatcaacatgaccaaccactcctacttcaacctcagcggc
caggagaccatcgacggcacaaacatcaccctcccaaccaacaaatacctcgctgttgac
gaaggtctcatccccactggcaagatcgaacccttcccaggtgtcaacgccaatgaggcc
gtcctcatgggagtaaaggagcccaacatcgaccactgcttcgtcctcaacacggacccc
tcctcagtgcccctcgacacccgctccgagccccttaacctcaacctcaaggcccaccac
gccggcgccggcgtcaacctcgaagtcctgagcactgagcccactttccaggtctacact
ggctccggcatcgacgtgcccgaggttaatggcaaggctgcccgtatttcgcgcagcggt
ttctgctgcgagcctgcgcgctatgtcaacgccgccaacgtccccgagtggaagaatatg
gtcctgcttaagaagggagacacgtacggcgccaggatcgtgtacaaggcctgggcagac
taa

DBGET integrated database retrieval system